tg1989

Coordinates:1897510-1898058

>tg1989 LSU ribosomal protein L5P (rpl5P)
MQINREAILADWEAHPMRRPRIAKLTINIGVGESGERLTKAEKMLEQLVGQKPIRRRAKQTNRDFGIRRGEPIAVKVTLR
GKKAYEMLDRLLEAVDRKLSVGNFDEHGNFCFGIQEHINIPGVEYDPEIGIFGMDVCVTLERPGFRVAKRKRQRRKIPTR
HKLTKEEGIVFAIEEFKVNVEGL

>tg1989 LSU ribosomal protein L5P (rpl5P)
atgcagatcaacagagaggccatccttgcagactgggaagctcacccgatgaggagaccgaggatagctaagcttaccat
aaacatcggtgtcggtgaaagcggtgagcgcttgaccaaggccgagaagatgcttgaacagctcgtcggccagaagccga
taaggaggcgcgcgaagcagaccaacagagacttcggaataaggcgtggtgagccgatagcggttaaggtcaccctccgt
ggaaagaaggcctacgagatgcttgacaggctccttgaggccgttgacaggaagctcagcgtcggcaacttcgacgagca
cgggaacttctgctttggaatccaggagcacatcaacataccgggcgtcgagtacgaccccgagataggtatcttcggta
tggatgtctgcgtcacccttgagaggcccggttttagggtcgccaagaggaagaggcagaggaggaagataccgaccagg
cacaagctgacgaaggaagagggtatagtcttcgctattgaggagttcaaggtcaacgtggagggattg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1897010 - 1898558 (Additional range around tg1989 is :500nt.)

>Thermococcus gammatolerans EJ3 AGTTCCCGGTCGGAATCATGGACGTCGTCTCGATTCCCGAGACCGGCGAGCACTACAGGGTCCTACCAAACAGGATTGGC AAGCTCATCCTCCATCCGATAAGCGAGGAGGAGGCAAAGCTCAAGCCCTTCAGGATCAACAACAAGAGGATGGTTAAGGG CGCTAGGGTTCAGCTCAACCTTCACGACGGGAGCAACCACTTAGTCAGCCTTGCTGAGAAGGACAGCTTCAGGACATCGT ACACGATAATCATGAAGGTTCCGGAGAGGGAGATCATTGAGGTCATACCGTTCGAGGTCGGCGCCTACGTCTTCGTCACC CAGGGTAAGAACGTTGCCAGGAAGGGTAGGATCGTGGAGGTCAGGCACTTCCCGATGGGCTGGCCCGACGTCGTCACGAT TGAGGACGAGAGTGGAGAGAAATTCGACACCCTGAAGGAGTACGCCTTCGTCGTTGGTAAGGAAAAGCCGGAGATTTCCC TTCCGTGAGGTGAGATGAG atgcagatcaacagagaggccatccttgcagactgggaagctcacccgatgaggagaccg aggatagctaagcttaccataaacatcggtgtcggtgaaagcggtgagcgcttgaccaaggccgagaagatgcttgaaca gctcgtcggccagaagccgataaggaggcgcgcgaagcagaccaacagagacttcggaataaggcgtggtgagccgatag cggttaaggtcaccctccgtggaaagaaggcctacgagatgcttgacaggctccttgaggccgttgacaggaagctcagc gtcggcaacttcgacgagcacgggaacttctgctttggaatccaggagcacatcaacataccgggcgtcgagtacgaccc cgagataggtatcttcggtatggatgtctgcgtcacccttgagaggcccggttttagggtcgccaagaggaagaggcaga ggaggaagataccgaccaggcacaagctgacgaaggaagagggtatagtcttcgctattgaggagttcaaggtcaacgtg gagggattg TGAGATGGCGAAGGCTGATTACAACAAGAGGAAGCCGAGGAAGTTTGGTAAGGGAGCGAGAAGGTGCATG CGCTGCGGCCAGTACGGGCCGATAATCAGAATACACGGCCTTATGCTGTGCAGACACTGCTTCCGCGAGGTCGCCCCAAA ACTCGGCTTCAAGAAGTATGAGTGAGGTGAGATGAAATGACTCTGCTTGACCCGCTTGCGAACGCTCTATCCCATATAAC CAACAGCGAGAGGGTAGGGAAGAAGGAGGTCTACATAAAGCCCGCCTCGAAGCTCATCGGCGAAGTGCTGAGAGTTATGC AGGAGAACGGCTACATCGGCGAGTTCGAGTTCATAGACGACGGGAGGGCCGGCATCTACAGGGTTCAGCTCATCGGCAAG ATAAACAAGGCCGGCGCGATTAAGCCCCGCTTCCCTGTTAAGGCAAAGAACTACGAGTACTGGGAGAAGAGGTTCCTTCC AGCGTTCGAGTTCGGAATCCTCATAGTGTC