tg1992

Coordinates:1899180-1899602

>tg1992 LSU ribosomal protein L14P (rpl14P)
MAKKGAGATRGVSPVRPTRALPVGAYLKVADNSGAKVIQIIGVVGYKGTRRRLASAGVGDMVVATVKKGRPDIRHQVVRA
VIVRQRKEYRRLDGMRVKFEDNAAAIVTPEGVPRGTEIRGAIAREAAERWVRLGSIASIVL

>tg1992 LSU ribosomal protein L14P (rpl14P)
atggccaagaagggtgctggtgcgaccaggggagttagccccgtcaggccaactcgcgctcttccggttggggcttacct
caaggttgccgacaacagcggtgcaaaggtcattcagataatcggtgtcgttggctacaagggaaccaggaggaggcttg
ccagcgctggagtcggcgacatggtcgttgccaccgtcaagaaaggaaggcccgacataaggcaccaggtcgttagggcc
gtcatcgtcaggcagaggaaggagtacagaaggctcgacggcatgcgcgtcaagttcgaggacaacgcggcagctatagt
cactcccgaaggcgttccgaggggaaccgaaatcaggggtgcaatagccagggaagccgccgagaggtgggttaggctcg
gcagcatagcgagcatagttttg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1898680 - 1900102 (Additional range around tg1992 is :500nt.)

>Thermococcus gammatolerans EJ3 ACACTCTCACAATAGTTGGTGATAGGGTCTGGACCGTTCCTAAGGACGTGGTCGAGATCGAGTTTGAAACGGCCGCCGGC GAAAAGATTAGAGTCGATGGAAGGAACTTGGTGGGAAGACCTGAGATGAGGTTGAAGAAGAGGTGGCGGAAATGAGAGAG ATTGGATTGAGGGTTCAGCCTCCCGCTGAGGTGTGTAACGATCCCAAGTGCCCCTGGCACGGGAACCTCAAGATACACGG GAGATACTTCGAGGGAATAGTCGTCAGCGACAAGGGTAAGAAGACGGTCGTCGTCGAGAGGAGACACTACAAGTACCTCA AGAAATACGAGCGTTACGAGCTCAGAAGGAGCAAAGTCCATGCCCACAACCCAGAGTGCATCAACGCAAAAACTGGCGAC AAGGTCCTCATAGCCGAGACCAGGCCGATAAGCAAGACTAAGAGCTTCGTCGTCGTTGCAGTCCTTGAGAGGGCCGAGAG AATGGAGGAGGTGTGAAGT atggccaagaagggtgctggtgcgaccaggggagttagccccgtcaggccaactcgcgct cttccggttggggcttacctcaaggttgccgacaacagcggtgcaaaggtcattcagataatcggtgtcgttggctacaa gggaaccaggaggaggcttgccagcgctggagtcggcgacatggtcgttgccaccgtcaagaaaggaaggcccgacataa ggcaccaggtcgttagggccgtcatcgtcaggcagaggaaggagtacagaaggctcgacggcatgcgcgtcaagttcgag gacaacgcggcagctatagtcactcccgaaggcgttccgaggggaaccgaaatcaggggtgcaatagccagggaagccgc cgagaggtgggttaggctcggcagcatagcgagcatagttttg TGAGGTGAGAGTTATGAAGCTTGACATGAAGCAGCC GAGAAAGCAGAGGAAGTTCCTCTACAACGCTCCCCTTCACCTTAGGCAGAAGATAATGGCGGCTCCACTCAGCAAGGAGC TCCGCGAGAAGTATGGTGTGAGAAACCTGCCGATTAGGGAAGGCGACAAAGTAAGGGTAATGCGCGGTGACTTCAAGGGT AAGGAGGGCAAAGTGCTCGAGGTTGACCTCAAGCGTTACAGGATTCACGTTGAAGGTGTCACCATGACCAAGACCGACGG GACCGAGGTCTTCTACCCGCTCCACCCGTCGAACGTTATGATAATCGAGCTCAACCTTGAGGACGAAGAGAGGAAGAAAA TAATTGAGAGGAGGGCTGCCTGATGGCGAGAAAAGGCGCGAAGAGGCACCTTAAGAGACTTGCCGCTCCGACTTCATGGT ATATCCACAGGAAGGAATACAAGTGGGCCGTTAGGCCGAGGCCGGGTCCCCACAGCATGCAGAC