tg1995

Coordinates:1900216-1900509

>tg1995 Protein translation factor SUI1-like protein (SUI1)
MPRIVNPLDEMLFKEVLKEQQRIRVYIERARYGKLKTIIEGIDEKEFDLEDIAKKLKAKLACGGTVKKGRIELQGDHRDR
IKKLLADLGFSEELIEVE

>tg1995 Protein translation factor SUI1-like protein (SUI1)
gtgccgaggattgtgaaccctctggatgagatgctctttaaggaggtcctgaaggagcagcagaggattagggtctacat
cgagagggcccgctacggaaagcttaagaccataatcgagggcatagacgagaaggagttcgacctcgaagacatagcaa
agaagctgaaggcgaagctggcatgtggcggaaccgtaaagaagggaaggatagagctccagggcgaccacagggaccgt
atcaagaagttgctcgcagaccttggattttcagaggagctcatagaggtcgag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1899716 - 1901009 (Additional range around tg1995 is :500nt.)

>Thermococcus gammatolerans EJ3 TTCAGGAGGGCCGCTTACTCCGCAATCAGGGCCATCATGAGGAACGGAGCGAGGGGCGTTGAGATTAGGCTCAGCGGAAA GCTCACCGGTGAAAGAGCTAAAAGCGTCAGGTTTTATCAGGGCTACCTCGCCAAGGTCGGAAACCCGGCCGAGACCCTTG TCAGCAAAGGCTATGCTCAGGCGTTGCTCAAGCTCGGCGTCATCGGCGTTAAGGTTGCCATCATGCCGCCCGACGCGAGG TTGCCCGATGAGATTGAGGTCAAGGAGATAGTCGAGGAAGAGGTGAGCGGCAATGAAGCCCAGTGAGATTAGGGAGATGA GCATCGAGGAGATAGACGAGAAGATAAGGCAGCTCCGCCTCGAGCTCGCCAAGGAGAGGGGTATGCTCACCATGGGGACC TCAACCGAGAACCCCATGGTAATAAGGAACCTCAGGCGCGACATCGCGCGCCTGCTTACCATAAAGAAGGAGAAGCTTAG GGAGAAAAGGTGAGGTTAG gtgccgaggattgtgaaccctctggatgagatgctctttaaggaggtcctgaaggagcag cagaggattagggtctacatcgagagggcccgctacggaaagcttaagaccataatcgagggcatagacgagaaggagtt cgacctcgaagacatagcaaagaagctgaaggcgaagctggcatgtggcggaaccgtaaagaagggaaggatagagctcc agggcgaccacagggaccgtatcaagaagttgctcgcagaccttggattttcagaggagctcatagaggtcgag TGACG CGGAAAAACATAGTCTGGCACGAGCTCATAGGGCTAAAGGCAAGAATTATAAGGGCATCTCATCCAGAGCTGGTCGGCAT CGAGGGCTACGTCCTTGATGAAACCCGTAACACTCTCACAATAGTTGGTGATAGGGTCTGGACCGTTCCTAAGGACGTGG TCGAGATCGAGTTTGAAACGGCCGCCGGCGAAAAGATTAGAGTCGATGGAAGGAACTTGGTGGGAAGACCTGAGATGAGG TTGAAGAAGAGGTGGCGGAAATGAGAGAGATTGGATTGAGGGTTCAGCCTCCCGCTGAGGTGTGTAACGATCCCAAGTGC CCCTGGCACGGGAACCTCAAGATACACGGGAGATACTTCGAGGGAATAGTCGTCAGCGACAAGGGTAAGAAGACGGTCGT CGTCGAGAGGAGACACTACAAGTACCTCAAGAAATACGAGCGTTACGAGCTCAGAAGGAGCAAAGTCCATGCCCACAACC CAGAGTGCATCAACG