tg1997

Coordinates:1900706-1901332

>tg1997 SSU ribosomal protein S3P (rps3P)
MAIERYFIKEGVKEMLIDEYLEKELRRAGYGGIDIKKTPLGTKVIIFAASPGYVIGRGGRRIRELTRILERQFGLENPQI
EVEEIKNPYLNAKVQAVRLAQALERGIHFRRAAYSAIRAIMRNGARGVEIRLSGKLTGERAKSVRFYQGYLAKVGNPAET
LVSKGYAQALLKLGVIGVKVAIMPPDARLPDEIEVKEIVEEEVSGNEAQ

>tg1997 SSU ribosomal protein S3P (rps3P)
ttggccatcgagaggtacttcatcaaggaaggcgttaaagagatgctcatcgacgaataccttgagaaggagcttcgcag
ggcgggctacggtggaatagacatcaagaagactccccttggaaccaaggtcataattttcgccgccagccctggctacg
tcataggcaggggcggaagaaggataagggagctcaccagaatccttgagaggcagttcggccttgagaacccgcagatt
gaggtcgaggaaatcaagaacccctacctcaacgccaaggttcaggcggtaaggctcgcccaggcccttgagagaggcat
acacttcaggagggccgcttactccgcaatcagggccatcatgaggaacggagcgaggggcgttgagattaggctcagcg
gaaagctcaccggtgaaagagctaaaagcgtcaggttttatcagggctacctcgccaaggtcggaaacccggccgagacc
cttgtcagcaaaggctatgctcaggcgttgctcaagctcggcgtcatcggcgttaaggttgccatcatgccgcccgacgc
gaggttgcccgatgagattgaggtcaaggagatagtcgaggaagaggtgagcggcaatgaagcccag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1900206 - 1901832 (Additional range around tg1997 is :500nt.)

>Thermococcus gammatolerans EJ3 GGCCGTCAAGTGAGGTGGTTTAGATGAGCAGGGGCAGGTTTTCCTACTCATTCCAAAATTTTGACCCCGAGAGAATGGCT CGCGCGAGCGGAAGGGACCTCAGGATTTCACCCAAGCACAGCGTCGAGCTCCTCAGGGAAATAAGGGGCATGATGCTCAA CGACGCCCTCAAGTACCTCGACGATGTCATCGCCAAGAAGAGACCGGTTCCGATGAGGCGCTTCAACGACAGCCAGGGCC ACAAGCCGGGTAAGGGCTTCGGTCCGGGCCGCTACCCCGTCAAGGTCGCCAAGGCCGTCAAGAAAATACTCCTCAACGCC AGGAACAACGCCGAGCAGAAGGGTCTTGACGTCGACAGACTCAAAATAATCCACGCCGCTGCCCACAGGGGGCCCGTCCT CAGGGGCTACATCCCGAGGGCCTTCGGAAGGGCCACCCCGTTCAACGAGCAGACCACCCACATTGAGATAGTCGTCGAGG AGATTAGGAGGTGAGACCT ttggccatcgagaggtacttcatcaaggaaggcgttaaagagatgctcatcgacgaatac cttgagaaggagcttcgcagggcgggctacggtggaatagacatcaagaagactccccttggaaccaaggtcataatttt cgccgccagccctggctacgtcataggcaggggcggaagaaggataagggagctcaccagaatccttgagaggcagttcg gccttgagaacccgcagattgaggtcgaggaaatcaagaacccctacctcaacgccaaggttcaggcggtaaggctcgcc caggcccttgagagaggcatacacttcaggagggccgcttactccgcaatcagggccatcatgaggaacggagcgagggg cgttgagattaggctcagcggaaagctcaccggtgaaagagctaaaagcgtcaggttttatcagggctacctcgccaagg tcggaaacccggccgagacccttgtcagcaaaggctatgctcaggcgttgctcaagctcggcgtcatcggcgttaaggtt gccatcatgccgcccgacgcgaggttgcccgatgagattgaggtcaaggagatagtcgaggaagaggtgagcggcaatga agcccag TGAGATTAGGGAGATGAGCATCGAGGAGATAGACGAGAAGATAAGGCAGCTCCGCCTCGAGCTCGCCAAGGA GAGGGGTATGCTCACCATGGGGACCTCAACCGAGAACCCCATGGTAATAAGGAACCTCAGGCGCGACATCGCGCGCCTGC TTACCATAAAGAAGGAGAAGCTTAGGGAGAAAAGGTGAGGTTAGGTGCCGAGGATTGTGAACCCTCTGGATGAGATGCTC TTTAAGGAGGTCCTGAAGGAGCAGCAGAGGATTAGGGTCTACATCGAGAGGGCCCGCTACGGAAAGCTTAAGACCATAAT CGAGGGCATAGACGAGAAGGAGTTCGACCTCGAAGACATAGCAAAGAAGCTGAAGGCGAAGCTGGCATGTGGCGGAACCG TAAAGAAGGGAAGGATAGAGCTCCAGGGCGACCACAGGGACCGTATCAAGAAGTTGCTCGCAGACCTTGGATTTTCAGAG GAGCTCATAGAGGTCGAGTGACGCGGAA