tg2004

Coordinates:1905044-1905808

>tg2004 hypothetical protein TGAM_2004
MAWHVFIPDSLLEETDDPKIRTYKVGQVARACAIFGVEHIWIYRAGGRDGKFIKTVLEYMETPQYLRKRLFPLMPELRYV
GVVPPLRTPHHKLKGKPKVGEIREGYAFRKGRKIYADIGLDELAIVEGNIEGRATFRVVSTRPLKVVPAKPVEYWGYRVH
LSGKPLAKTLKKAHLDLAIATSRKGRDVRKVNLPPLEGEVGIAFGSPRKGVMELLGGEYEFDFVLNTIPNQKTKTVRTEE
ALLATLAIFNLIRRD

>tg2004 hypothetical protein TGAM_2004
atggcctggcacgtcttcattcccgattccctccttgaggaaaccgacgacccgaaaatcagaacgtacaaggttgggca
ggttgcgagggcctgcgcaatcttcggcgtcgagcacatctggatttacagggcaggcgggagggacgggaagttcataa
aaacggtccttgagtacatggaaacaccgcagtacctaaggaagaggctgtttcccctgatgccagagctccgctatgtg
ggcgtcgtccccccgctcaggacgccacatcacaagctcaagggaaaaccaaaggttggggaaatccgcgagggctacgc
cttccggaagggaaggaaaatctacgcggacatcgggctcgacgagctggcaatcgttgaggggaacattgagggcaggg
caacgttcagagtcgtctcaacgaggcccctcaaggtcgttccggcgaagccggttgagtactggggctacagggttcac
ctgagcgggaaacccctggcgaaaacacttaaaaaggctcacctggatttggcaatcgcgacctcgcggaagggtcgcga
cgtgagaaaggtcaaccttcccccgctcgaaggggaagttggtatcgcctttggctcgccgaggaagggcgttatggagc
tcctcggcggtgagtacgagtttgacttcgtgctcaacacgattccaaatcagaaaactaaaaccgtccgcaccgaggag
gcgctcctcgccacgctggcgatattcaatctcataaggagggat


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1904544 - 1906308 (Additional range around tg2004 is :500nt.)

>Thermococcus gammatolerans EJ3 AACTCCTCTCAATTCTCAACGGCTTTGAGATAAACACTTAAAATCTGCACAACACTTTCCGCCAGCGCTTGCGCGGGAAG CTTTTGGAAAAAACTTCACCAAAAGTTGGTAGCTTCTCGTCCAAAGGCTCAAATAGAGCAGATTTTGGTTGTAAAATGGT GCGTTTCAACGGAGAACACTCTCAAAATCCTTCAAAAAAATGGGTTTGTTCTCCTCTGACGCCCTTCAGGTGTCGATTCC AAAGTTAAACCCCACTTAAGAAGCAACTAGGAGATTTCTCACACTCAAAATGGCCAGTTAACAAGAAAATCTTCCAAAAT TTGACTCTCAAATAAGGAGCTACAACTTTGATGAAACTTTTGCAGAGCAAAAGTTTCCTTGCAAAAAAATTACACACATC CAATCACGAAAAAGGGTTGCAAGGTTCGAAAGCCTTTTAAATAGTCTCCATAAGCTCCCTTCAGCGCGTTGGGGTTAGGG AGGACAGTGGGGGCGAGAT atggcctggcacgtcttcattcccgattccctccttgaggaaaccgacgacccgaaaatc agaacgtacaaggttgggcaggttgcgagggcctgcgcaatcttcggcgtcgagcacatctggatttacagggcaggcgg gagggacgggaagttcataaaaacggtccttgagtacatggaaacaccgcagtacctaaggaagaggctgtttcccctga tgccagagctccgctatgtgggcgtcgtccccccgctcaggacgccacatcacaagctcaagggaaaaccaaaggttggg gaaatccgcgagggctacgccttccggaagggaaggaaaatctacgcggacatcgggctcgacgagctggcaatcgttga ggggaacattgagggcagggcaacgttcagagtcgtctcaacgaggcccctcaaggtcgttccggcgaagccggttgagt actggggctacagggttcacctgagcgggaaacccctggcgaaaacacttaaaaaggctcacctggatttggcaatcgcg acctcgcggaagggtcgcgacgtgagaaaggtcaaccttcccccgctcgaaggggaagttggtatcgcctttggctcgcc gaggaagggcgttatggagctcctcggcggtgagtacgagtttgacttcgtgctcaacacgattccaaatcagaaaacta aaaccgtccgcaccgaggaggcgctcctcgccacgctggcgatattcaatctcataaggagggat TGAGATGGGAAAGG TTCACAGACCAAGGAGAGGTTCACTCGCCTTCAGCCCGAGAAAAAGGGCTAGGAGTGTAGTCCCGAGAATCAAAAAGTGG CCAAAGGACAGTGAAGTCAGGATGCTGGGCTTTGCTGGTTACAAGGCCGGGATGACCCACATCCTTATGATAGACGACAG CCCCGGGCTCACCAAGGGCAAGGAGATATTCGTGCCCGTGACCATAGTGGAGGTTCCACCTCTCTTCGTTTACGGAATAA GGGCCTACAAACAGGGCTACCTCGGCCTTGAGACCGCCACCGAGGTCTGGTTCCACGAGCTCAACGACAACGTCAAGAGG CGCATAAAGACCCTGCCGAAGAACTACGGCGAAGAGGACTTCAAGGCCAAGCTCGGTCAGCTTGAGGACCTCGTCAACGA CGGCGAGATCGTCGACGTCAGGCTTCTCGTCCACACCCAGCCCTGGCTCATCAAGCTCAAGAAGAAGCCCGAAGTCATGG AGTACG