tg2010

Coordinates:1912602-1913147

>tg2010 LSU ribosomal protein L10 (rpl10E)
MGLRPAKIDRDVDKPAYTRREYIRGAPGPKITIFDMGNLSAEFEYEVSLHAEQAMQIRQNALEAIRIQVNRYLQKNVGRS
NYHFKIRVYPFQVLRENPMATGRKADRYGNGMRRPFGKPIGLAARVKKDQKILTVWVNEQHLKFALGAMHRAKMKLPYSA
YYRIYDREGNDVTTKVLSTMKR

>tg2010 LSU ribosomal protein L10 (rpl10E)
atgggacttagaccggcgaagatcgatagggacgttgacaagcccgcttacacgaggagggaatacatacgcggtgcccc
gggaccgaagataacgatattcgacatgggcaacctctcggccgagtttgaatacgaggtcagcctccacgccgagcagg
ccatgcagataaggcagaacgccctcgaggcgattcgtattcaggtcaacaggtacctccagaagaacgtcggcaggagc
aactaccacttcaagattcgcgtttacccgttccaggtgctccgtgagaacccgatggccaccggaaggaaggccgaccg
ttacggaaacggtatgcgcaggcccttcggaaagccgatcgggctcgccgctcgcgtaaagaaggatcagaagatactca
ccgtctgggtgaacgagcagcaccttaagttcgccctcggtgccatgcacagggccaagatgaagctgccatacagtgct
tactacaggatttacgacagggaaggaaacgacgtaacaacgaaagtcctctccacgatgaagcgc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1912102 - 1913647 (Additional range around tg2010 is :500nt.)

>Thermococcus gammatolerans EJ3 TTTACTCGGCTGGGTTAGCTTCCTCTCGGCGTTGCTCAGCTACTTCGTCTCGTGGGTTGCTGATGTTAGAAGCGAGGCGA GGATGGTAAAGCTCACCGCCCTTCTCGCGGGAATATCACCGATTTTGGCCTCGATAAAGACGGCCCCTACGGTCTTCCTC GGGATATTCTTTGCCCTCTTCGCCTTCCAGAGCTTCAGACCTATTTCGAGGAAAGTTCTGGCGAGCTACCACCGCTCATC GCTCGCGATAGGTGGGGTAAACGCCGTCCAGAACCTCTCGACTTTCATTGGAGGAATGCTCTTCGGCATAGCGTACTCGC TAGGAGAGGTGAACGTCGGGCTGACCCTGAACCTTGCGCTCCTGACGTTTCTACCCTTCTCGCTCGGGTTGATAATCGAA GGGACGAAGGTGAAAGATATATGAACGTCCAAAACTTTTATAAGGGTCTCAACTCGCCTAAGTTTAGGCTCTGGTTCACG CTCATTTGGAGGTGAGATT atgggacttagaccggcgaagatcgatagggacgttgacaagcccgcttacacgaggagg gaatacatacgcggtgccccgggaccgaagataacgatattcgacatgggcaacctctcggccgagtttgaatacgaggt cagcctccacgccgagcaggccatgcagataaggcagaacgccctcgaggcgattcgtattcaggtcaacaggtacctcc agaagaacgtcggcaggagcaactaccacttcaagattcgcgtttacccgttccaggtgctccgtgagaacccgatggcc accggaaggaaggccgaccgttacggaaacggtatgcgcaggcccttcggaaagccgatcgggctcgccgctcgcgtaaa gaaggatcagaagatactcaccgtctgggtgaacgagcagcaccttaagttcgccctcggtgccatgcacagggccaaga tgaagctgccatacagtgcttactacaggatttacgacagggaaggaaacgacgtaacaacgaaagtcctctccacgatg aagcgc TGAACGTTTCTCCACTTCTTTTTGCGTTTTCTGTCTTCTCCCTTGCCCTGTTTGGGTTTGACGATTTTTCTCA AACCAACGCCGTAAGTACTTTGATGCCCTATTCTGGACCGGTGATGCTATGAACCCCAGGGTTATAGGTTCGGTGGTTTT GGTGCTCCTCTTGATTTTTGGTTTGGCCGGCTACGTCGGCGCCTTTGGTGGGAAGGGAAAGGGAAGGCTTGAGTACAAGG TTTACAGCCTTGAGCAGATAATGTCGGGTGCCTACAAGGTATACGGCAATCCAAAACTCGGCTTCTGGGTTGCTAAAGTA GTTCTCCGGAACACAGGGGATGGACCGATAAGGAACATCCAGATCAGGTATTCGATAGACAACTACGCTTCAGAGTCCGT GAAGAGTTACCCAGTCCTCGTGCCGGGGGGAGCGGTCGTTGACTTCTACTATCCGATACTGTCGAGTGAGGTCACGAAGT TAACGGCCGCAACCCCTTCGAACCTGA