tg2015

Coordinates:1917260-1918159

>tg2015 Asparaginyl-tRNA synthetase related protein (asnS)
MNALQIVSRKIDPIAEVQTRAITYLTGELSRKGFRWLLPVMLSSITDPLWPEPSSEEALRPPEVEVYGEKLRLMHSMILH
KQMAVAMGIDKLFVLSPNVRLESRLADDGRHAYEFTQLDFEIARASMDDVMGLIEELIVGLFRELRPFVWESFERELPKP
RRPFKRFTLEEILEEFGSEEEASREMGEPFWITGIPREFYDREVDGIWRNYDLYLPEGYGEVSSGGEREWEYEKILAKIR
SAGLSEEAFRPYLEVAKAGLLRPSAGAGIGVERLIRYIVGAKHIAEVQPFPRIPGVPAVI

>tg2015 Asparaginyl-tRNA synthetase related protein (asnS)
atgaacgctctccaaattgtaagcaggaaaattgacccgatcgccgaggttcagacgagggctataacttatctcaccgg
cgagctgtcgaggaaaggcttccgctggttgctaccggtgatgctcagctcgataaccgacccgctctggcccgagcctt
cctccgaggaggccctgagaccgccggaggtcgaggtctacggggaaaagctcaggctgatgcatagtatgatactccac
aagcagatggccgtcgcgatggggatagataagctcttcgtcctctctccaaacgtgaggcttgagagccgtttggctga
cgacggaaggcacgcctacgagttcacccagctcgacttcgaaattgcccgcgcgagcatggacgacgttatgggcctga
tagaagagctcatcgtcggcctgttccgcgagttgagaccgttcgtctgggagtccttcgagagggagcttccaaagccg
aggaggcccttcaaacgcttcacccttgaggaaatcctcgaagagttcgggagcgaggaagaggcgagcagagaaatggg
agagcccttctggataacggggatcccgagggagttctacgacagggaagttgacggaatctggagaaactacgacctct
atttgcctgaaggctacggcgaggtttcgagcggtggcgagcgggagtgggagtacgagaagatactggccaagatacgc
tcggccggtctgagcgaggaggccttcaggccgtaccttgaggtggccaaggccggtctccttaggcccagcgcgggagc
cggaatcggcgtcgagaggctaatccgctacatcgtcggagcgaaacacatagccgaagtccagcccttcccgaggattc
cgggtgttccggcggtcatc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1916760 - 1918659 (Additional range around tg2015 is :500nt.)

>Thermococcus gammatolerans EJ3 TCCTTTCATCCGTCGAGCGCCGGTCGAAGGCAGTATCAATGACCTCGATGTTCGGCTTGAAGGGCTTGAATTCGCCGTAG GCAGTTACTACCGCTACCTTCCAGTCGTCGGGCACGTAGTGGAGTAGCGCTTCCACGAGCTTCGTCTTTCCGCTCCTGCT CGTTCCGACGATTAGTATGTCCTTCCTTCCGAGAACCTCTTCCCTCAGGAGCTCCATCTGCTCGGGCCTTGCCGAGCCGT AGCGTATCAAATCCTCGGGCTTGAAGATGTAGACGCCCATTCGCTTCACCGTAGGTAGTTCTCGCCGGGGGTTATAATTC TGCCGTTCGAGTGGTTGTGCCTTTGAAATTCTTCTTTGATGTTATGACATCATATTTTGTATTTTCTTGTCATCTTCTCG TGAATTTCCTGGAAATTTCATCATTTTTGGCGAAAATTCAAAATTTTCTGCACAAAGGCAATAAACCCGAAGGCACTCTG ACGAAAATTGGGTGATTGAT atgaacgctctccaaattgtaagcaggaaaattgacccgatcgccgaggttcagacgag ggctataacttatctcaccggcgagctgtcgaggaaaggcttccgctggttgctaccggtgatgctcagctcgataaccg acccgctctggcccgagccttcctccgaggaggccctgagaccgccggaggtcgaggtctacggggaaaagctcaggctg atgcatagtatgatactccacaagcagatggccgtcgcgatggggatagataagctcttcgtcctctctccaaacgtgag gcttgagagccgtttggctgacgacggaaggcacgcctacgagttcacccagctcgacttcgaaattgcccgcgcgagca tggacgacgttatgggcctgatagaagagctcatcgtcggcctgttccgcgagttgagaccgttcgtctgggagtccttc gagagggagcttccaaagccgaggaggcccttcaaacgcttcacccttgaggaaatcctcgaagagttcgggagcgagga agaggcgagcagagaaatgggagagcccttctggataacggggatcccgagggagttctacgacagggaagttgacggaa tctggagaaactacgacctctatttgcctgaaggctacggcgaggtttcgagcggtggcgagcgggagtgggagtacgag aagatactggccaagatacgctcggccggtctgagcgaggaggccttcaggccgtaccttgaggtggccaaggccggtct ccttaggcccagcgcgggagccggaatcggcgtcgagaggctaatccgctacatcgtcggagcgaaacacatagccgaag tccagcccttcccgaggattccgggtgttccggcggtcatc TGATTCTCGAATCCTTTTTATTGTGGTTTTCTCAAATT CTCTCGGTGGGAACATGGGGTTGTTCGATTTTCTGAGAAGGCCGAGGAAAGGTGAATCCAGAGAGTTCATAGCGTCGAGG AAACCGGTCGCGAAGTTCAGGGTGGAACAGATCCTTAACGTCCTCGGCAGGGAGACGCTGATTGGAACCGTTGAGGGGAT AATATACCCCGGCTACAAGGTCAAAGGGCGGAGCATCGCCCTAATCCGAGAAATCCAGAAGGAGCGGAAAAAGGTTGACT TCGCGGTTGACGGCGACAGGGTCGCGCTAATTCTTGAGGGGAAGACAAACGCTAAAAAAGGCGACGTCCTCGCGGTCTAC CAGTCGTGAGGTGGGAGCATGATAATCCTCGACGACCACTTCCACGTTGACCCCTTCAAGGGCCTCTTCCTCGAGGCGGT GAAGCAGTTTCACAGGGCTGGAGGAACGCACCTGATGGTCGTCTACAAGACGGCCCACGAC