tg2019

Coordinates:1919800-1919985

>tg2019 hypothetical protein TGAM_2019
MEGVEYIYDEHGRIKGVIIPPELWEKVKGELFDPSRYRGIYKGKKDLEKSLRELREEWERDF

>tg2019 hypothetical protein TGAM_2019
atggaaggtgttgagtatatatacgatgagcatggacgaattaagggtgtgataataccgccagaactttgggagaaagt
taagggcgagctctttgatccgtcaagatataggggtatttataagggcaagaaggaccttgagaagagcctcagggagc
tgagggaggaatgggagagagatttt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1919300 - 1920485 (Additional range around tg2019 is :500nt.)

>Thermococcus gammatolerans EJ3 ACAAATTTACCGGCCCACGTCGCGGAGAGGCAGGCGAAATCGGCGGAGGAGAGATTGAGAGAGTTTTTCAATGCCCCTGT TGAGATAGAGACTGAAGTATCACGTTCTCTTGGGCCCGGAAGCGGAATAGTGGTTTGGGCCGAGACGGACTCGCTTAGGT TAGCTGGAGACGCCCTCGGAAAGCGCGGAAAGCCGGCAGAGGTAGTCGGCAGGGAAGCCGCTGAAGAGCTGATTGAGCAA CTGACGCCGAGGAAGGCCGTTGACAGGTTCCTCGGCGACCAGCTGATACCGTTCCTGGCCTTCGCGGGCGGAGAGATAGG CGTTGCAGAAATCACGAACCACCTCGTCACCAATGTCTGGGTCGTGGAGCGGTTTTTGGGTAGAACTTTCGAAGTCGAGG GAGAAATCGGAGAGCCCGGGGTTGTGAGGGTGGTAAGGAAGGCGGAGGTCTGACGAAGGGGTTAAATATGCCACAGTTCT TAGTAATGATGGTGAGAGA atggaaggtgttgagtatatatacgatgagcatggacgaattaagggtgtgataataccg ccagaactttgggagaaagttaagggcgagctctttgatccgtcaagatataggggtatttataagggcaagaaggacct tgagaagagcctcagggagctgagggaggaatgggagagagatttt TGATTGACACCAACATTCTCATCTACTACCTTG CGGACGCCATTCCTAAAGAGGAACTTCCAACGATTGAGGAAATCCTTAGAGGAAGCTTCAACGTCTCCATAATCACAAAA ATAGAGTTCCTTGGCTGGAAAGGACACACTCAAGAGGGTTTTGAAAAGTCAAAGGAGTTCATAAGCTTCGCAAACGTCAT ACCACTCACTGATGAGATAGGAGACGTTGCCATTGAACTCAGGCGAAGGGTTAGTATAAAGCTCCCGGATGCAGTTATAG CGGCGACGGCACTCGTTCACAATTTAACTCTCGTCACGAGGAACGTTAAAGACTTTAAGAGGATTGAAGGACTGAGAATA TACAACCCCTTTGAAAAGGTAGATAAAAAGCAGTGACCTCCTGCCCTGCAGACATCTCCTAAGCTTTACTCCTCCATCTC CACCCCGTAGACCTTCCTCGGGTTCTCGACGTGGATTTTGTAGACGTCCTCCTCGGTGAACAGGCCG