tg2028

Coordinates:1929205-1929660

>tg2028 Methylmalonyl-CoA decarboxylase gamma chain (MmdC)
MKVKVIIDGREYEVEVEELGGGKFRVSFEGKSYEVKAEGLGIALPSVPETTSAPVSAPASVSVPAPAPVSAPAPSPAPAS
ASPNTVTAPMPGKILRVLVSEGQEVKAGQGLLVLEAMKMENEIPAPKDGVVKKIYVKEGDAVNTGDPLVELG

>tg2028 Methylmalonyl-CoA decarboxylase gamma chain (MmdC)
atgaaggttaaggtcatcatcgatggaagggagtacgaggtcgaggttgaggagctcggtggtggaaagttcagggtcag
cttcgagggcaagagctacgaggtcaaggctgaaggactgggaatagcgcttccgagcgttcccgaaactaccagcgctc
cggtttctgctccagcttctgtgtcggttcctgctcccgcccctgtgagtgctcctgcgccctcgcccgctcctgcgagt
gcttcgccgaatactgttacggctccaatgccgggtaagattctcagggttcttgttagtgaggggcaggaggttaaggc
tggtcagggtttgcttgtgcttgaggccatgaagatggagaacgaaattcccgctccgaaagacggtgttgttaagaaaa
tctacgtgaaagaaggcgacgccgtaaacaccggcgacccactagtagaactcggg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1928705 - 1930160 (Additional range around tg2028 is :500nt.)

>Thermococcus gammatolerans EJ3 TACATCGACGACGTCATCGACCCGGCAGAGACGAGGGGCAAGGTCATAATGGCGCTTGAGGCCCTCGAGAGCAAGCGCGT CAAACTCCCGCCGAAGAAGCACGGCAACATACCCCTGTGAGGTGAAAGCATGAGCCAGTTTGCCGAGGGCGGATGGATTA CAATCATAGGAATCACCGTCGTCTTCGCCATACTCGCGATACTCGCGATAGTGATGTACGCCATAGGCGCCTTCGAGCGC GGGATGACGAAGAAGGTCGAGAAGGAAGAGAAAGCCGTCGAGGAGACGAAGGAGGAGGTTGAGACCCCGGAGGAGGAAAT TCCCCCAAGGGATTTGGCGGTCATAACCGCCTCAATCCTCGCCTACCTCGCGAAGAAGGCCGAGGTGGTTCGTCCTTTAC CCTTCAGGAGGAAGGTTTCCGACGCCTGGCGCCTCTACGGTTTGCAGAGCGGTATGGATGAGGTTGAGAACTTCAACTAC GAGATGAGGAAGTGGTGAAG atgaaggttaaggtcatcatcgatggaagggagtacgaggtcgaggttgaggagctcgg tggtggaaagttcagggtcagcttcgagggcaagagctacgaggtcaaggctgaaggactgggaatagcgcttccgagcg ttcccgaaactaccagcgctccggtttctgctccagcttctgtgtcggttcctgctcccgcccctgtgagtgctcctgcg ccctcgcccgctcctgcgagtgcttcgccgaatactgttacggctccaatgccgggtaagattctcagggttcttgttag tgaggggcaggaggttaaggctggtcagggtttgcttgtgcttgaggccatgaagatggagaacgaaattcccgctccga aagacggtgttgttaagaaaatctacgtgaaagaaggcgacgccgtaaacaccggcgacccactagtagaactcggg TG ATGGGGCATGACGAGCTTCGTGGACTTCCTGAGCACAATGGGTCTGCTCCACCTCACGGTAGGGAACATCATCATGATTG CAGTGGGCCTGACGCTGGTTTACCTTGCGATACGCTACGAGATGGAACCGCTGTTGCTTTTGCCCATAGGCATCACGGCG GTTCTCGTTAACCTCCCCCTCAACGGCATAGCCAACTGCCCGACCGTTGGGCCCCTCTGCAGTCACCCGGGCCTGCTCGA CATAGTCTACCACTACCTCATCAAGACCGAGATAGTGCCCCTGCTCATCTTCTTCGGCCTTGGAGCAATGACGGACTTCG GGCCGATGATTGCAGATCCTAAGACCGCCCTTATGGGCGCCGCGGCACAGATAGGTGTCTTCGTGGCGATGCTAACTGCC TTGGCCCTGGGCTTCAACCTCCACCAAGCGGCTTCGATAGGAATCATAGGCGGTGCGGACGGACCGACGACGATATATCT GACCACCAAGCTGGCCC