tg2037

Coordinates:1936595-1937356

>tg2037 Exosome complex RNA-binding protein 1, Rrp4p-like protein (Rrp4p)
MRRIFVKPRELVVPGTLLAQGPFKNGRGTFREGNRIYSTVVGLVEIRGDLIRVIPLEGPYIPEVGDNVLGKIVDVRFSNW
TVDIGAPYQANLRVQDAVEERIDLLKTDLRKIYDIGDIIYAKIKAYNEVNQIDLTTKGMPFKGGPLRGGQLVTITPSKVP
RVIGKGGSMINMIKRLTGTRIIVGQNGWVWVSGKNDELEKLAVEAILKVDRESHTQGLTDRVKEFLLSRLRELKERGVIE
EIPQLEENNEGEGK

>tg2037 Exosome complex RNA-binding protein 1, Rrp4p-like protein (Rrp4p)
atgaggaggatttttgtaaaaccaagggagttagtggttcccgggacacttttggcccaggggccctttaagaacggaag
aggaaccttcagagaagggaacaggatatactcgactgtggtaggactggtcgagatcaggggggaccttatacgggtta
taccccttgagggaccatacataccggaggttggggacaacgttcttggaaagatcgtggacgtccggttctccaactgg
actgtggacataggcgcgccgtatcaggcgaacctccgcgttcaggatgctgtggaggagcgcatagaccttctcaaaac
agacctgaggaagatctacgacatcggcgatataatctacgccaagataaaggcctacaacgaggtcaaccagatcgacc
tgactaccaagggaatgcccttcaagggcggtcccctcaggggaggccagctcgtcacgataaccccctccaaggttccg
agggtcatcggtaagggaggttcgatgatcaacatgatcaagaggctgaccggaacgaggatcatagtgggtcagaacgg
atgggtctgggtgagcggcaagaacgatgagcttgagaagctggcggtggaagcgatcctcaaggttgatcgtgaaagcc
acacccaggggctcacagacagggttaaggagttcctcctctcccggctcagggagctcaaggagaggggagtgatcgag
gagataccccagcttgaggagaataacgagggtgaaggaaaa


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1936095 - 1937856 (Additional range around tg2037 is :500nt.)

>Thermococcus gammatolerans EJ3 CGAGCGATCCCTACGAGGTCGCCAAGATAATCCTCAGAAAGGGAGAAGTTCAGCTGACGGCGGAGCAGAGGAGACAGATG CTCGAGGACAAGAAGAAGTACATAGCGACGATAATCCACAGACATGCCGTCGATCCGAGGACTGGATATCCCCACCCTGT CGATAGGATCCTCAGGGCGATGGAGGAGGCAGGGGTCCACGTGGATCTCTTCAAGGACGCCGAGGCACAGGTTCCACAGG TGATCAAGGCCATAAGGCCGCTTCTCCCAATAAAGCTTGAAGTCAAGGTCATAGCGGTGAAGATACCGAGCGACTATGTC GGTAGGGCCTACGGGGAGGTCAGAAAGTTCGGCAGCATAAAGAGGGAGGAGTGGGCCAGCGACGGCTCGTGGATGTTCCT GATCGAGATTCCCGGAGGAATAGAGGAGGAGTTTTATGAGAAACTCAACGCCCTTACCAAGGGCACCGCGATTACCAAAC TTGTAGAGAGGAAGGGCCT atgaggaggatttttgtaaaaccaagggagttagtggttcccgggacacttttggcccag gggccctttaagaacggaagaggaaccttcagagaagggaacaggatatactcgactgtggtaggactggtcgagatcag gggggaccttatacgggttataccccttgagggaccatacataccggaggttggggacaacgttcttggaaagatcgtgg acgtccggttctccaactggactgtggacataggcgcgccgtatcaggcgaacctccgcgttcaggatgctgtggaggag cgcatagaccttctcaaaacagacctgaggaagatctacgacatcggcgatataatctacgccaagataaaggcctacaa cgaggtcaaccagatcgacctgactaccaagggaatgcccttcaagggcggtcccctcaggggaggccagctcgtcacga taaccccctccaaggttccgagggtcatcggtaagggaggttcgatgatcaacatgatcaagaggctgaccggaacgagg atcatagtgggtcagaacggatgggtctgggtgagcggcaagaacgatgagcttgagaagctggcggtggaagcgatcct caaggttgatcgtgaaagccacacccaggggctcacagacagggttaaggagttcctcctctcccggctcagggagctca aggagaggggagtgatcgaggagataccccagcttgaggagaataacgagggtgaaggaaaa TGATGGGTAGGCCAGAG GGTTTAAAGCTCATCGATGAGAACGGCAGGAGAATAGACGGAAGGAGGAAGTATGAGCTGAGGAAAATCCACATGGAAGT CGGTGTTCTGAAGAACGCAGACGGATCCGCGTATATCGAATGGGGTAAGAACAAGATACTCGCGGCCGTTTACGGTCCGA GGGAGATACACCCAAAACACCTTCAGAGGCCTGACACGGCAGTCCTGCGCGTCCGCTACAACATGGCCCCGTTCAGCGTG GAGGAGAGGAAAAAGCCCGGTCCCGACAGGAGGAGCGTTGAAATAAGCAAGGTCATAAGGGGCGCGCTTGAGCCTGCTTT GATCCTTGAAATGTTCCCGAGGACAGTCGTTGACGTCTTCATCGAGGTTCTCCAGGCCGACGCTGGAACGAGGGTTGCCG GAATAACCGCAGCATCGCTCGCTTTGGCCGATGCGGGAGTTCCGATGAGGGATCTCGTGGCAGCTTGTGCCGCTGGAAAG ATC