tg2038

Coordinates:1937356-1938063

>tg2038 Shwachman-Bodian-Diamond syndrome (SBDS) related protein, possibly a translation elongation factor EFG/EF2
MPISVDKAVIARLKTHGETFEILVDPYLARDFKEGKDVPIEEILATPYVFKDAHKGDKASEHEMEKIFGTSDPYEVAKII
LRKGEVQLTAEQRRQMLEDKKKYIATIIHRHAVDPRTGYPHPVDRILRAMEEAGVHVDLFKDAEAQVPQVIKAIRPLLPI
KLEVKVIAVKIPSDYVGRAYGEVRKFGSIKREEWASDGSWMFLIEIPGGIEEEFYEKLNALTKGTAITKLVERKGL

>tg2038 Shwachman-Bodian-Diamond syndrome (SBDS) related protein, possibly a translation elongation factor EFG/EF2
atgcccatcagtgtagataaagccgttatcgcccgtcttaaaactcacggcgagacctttgaaatactcgttgaccctta
cctagccagggatttcaaagagggcaaggatgttcccatagaggagatccttgcaacgccttacgttttcaaagatgcac
acaagggtgacaaggcgagcgagcacgagatggagaagatattcgggacgagcgatccctacgaggtcgccaagataatc
ctcagaaagggagaagttcagctgacggcggagcagaggagacagatgctcgaggacaagaagaagtacatagcgacgat
aatccacagacatgccgtcgatccgaggactggatatccccaccctgtcgataggatcctcagggcgatggaggaggcag
gggtccacgtggatctcttcaaggacgccgaggcacaggttccacaggtgatcaaggccataaggccgcttctcccaata
aagcttgaagtcaaggtcatagcggtgaagataccgagcgactatgtcggtagggcctacggggaggtcagaaagttcgg
cagcataaagagggaggagtgggccagcgacggctcgtggatgttcctgatcgagattcccggaggaatagaggaggagt
tttatgagaaactcaacgcccttaccaagggcaccgcgattaccaaacttgtagagaggaagggccta


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1936856 - 1938563 (Additional range around tg2038 is :500nt.)

>Thermococcus gammatolerans EJ3 AAATATACCGCCTGACATACGGCGAACCCGTCCCGCTCACCGTTCTGGTGAAGAAGATATGCGACCTCAAGCAGGCCCAC ACCCAGTACGGCGGTGTGAGGCCCTTCGGTGCAGCTCTGCTGATGGCGGGCGTTAACGAGAAGCCCGAGCTCTATGAAAC AGACCCGAGCGGCGCCTACTTTGAGTGGAAGGCTGTCGCTATAGGAAGCGGCAGGAACACAGCGATGGCGATATTTGAAG AGCACTACAGCGACGATATCGATATGGAAGGAGCGATAAAGCTCGCCATACTGGCCCTTGCAAAGACCCTTGAGGAACCC AGCCCTGAGAGCATCGAGGTCGCCTACATAACCCTTGACGAGAAGCGCTGGAAAAAGCTTGATAAGGAAGAGGTTGCAAA GTACCTCAATGAGATCCTCGAGGAGATCAAGGAAGAGGAAGTCGAGGAGCGGGAAGAGGATTACTCCGAGCTTGACCAGA ACTACTGAGGTGACGGGCG atgcccatcagtgtagataaagccgttatcgcccgtcttaaaactcacggcgagaccttt gaaatactcgttgacccttacctagccagggatttcaaagagggcaaggatgttcccatagaggagatccttgcaacgcc ttacgttttcaaagatgcacacaagggtgacaaggcgagcgagcacgagatggagaagatattcgggacgagcgatccct acgaggtcgccaagataatcctcagaaagggagaagttcagctgacggcggagcagaggagacagatgctcgaggacaag aagaagtacatagcgacgataatccacagacatgccgtcgatccgaggactggatatccccaccctgtcgataggatcct cagggcgatggaggaggcaggggtccacgtggatctcttcaaggacgccgaggcacaggttccacaggtgatcaaggcca taaggccgcttctcccaataaagcttgaagtcaaggtcatagcggtgaagataccgagcgactatgtcggtagggcctac ggggaggtcagaaagttcggcagcataaagagggaggagtgggccagcgacggctcgtggatgttcctgatcgagattcc cggaggaatagaggaggagttttatgagaaactcaacgcccttaccaagggcaccgcgattaccaaacttgtagagagga agggccta TGAGGAGGATTTTTGTAAAACCAAGGGAGTTAGTGGTTCCCGGGACACTTTTGGCCCAGGGGCCCTTTAAG AACGGAAGAGGAACCTTCAGAGAAGGGAACAGGATATACTCGACTGTGGTAGGACTGGTCGAGATCAGGGGGGACCTTAT ACGGGTTATACCCCTTGAGGGACCATACATACCGGAGGTTGGGGACAACGTTCTTGGAAAGATCGTGGACGTCCGGTTCT CCAACTGGACTGTGGACATAGGCGCGCCGTATCAGGCGAACCTCCGCGTTCAGGATGCTGTGGAGGAGCGCATAGACCTT CTCAAAACAGACCTGAGGAAGATCTACGACATCGGCGATATAATCTACGCCAAGATAAAGGCCTACAACGAGGTCAACCA GATCGACCTGACTACCAAGGGAATGCCCTTCAAGGGCGGTCCCCTCAGGGGAGGCCAGCTCGTCACGATAACCCCCTCCA AGGTTCCGAGGGTCATCGGTAAGGGAGGT