tg2042

Coordinates:1939747-1940328

>tg2042 Indolepyruvate ferredoxin oxidoreductase beta subunit (iorB)
MEFNLIITGVGGQGGLTLSRIVGNAAMVEGYNVRIGETLGMSQRYGSVLSYLRFGEGVYSPLIEEGKANLMLALEPAEAL
RNARFLGKNSVAIVNAYPIHTATTLVGKERYPELDEIEKAIGRICPVHMMNFQREADKINPRTLGVLMLGYAYGKGLIPL
KRESLLEGIRLTLREKLWEMNFRAFERGEELAKA

>tg2042 Indolepyruvate ferredoxin oxidoreductase beta subunit (iorB)
atggagttcaacctcatcattaccggagtcggcggtcagggaggtcttaccctttcgaggatagtcggaaacgcggccat
ggtcgagggctacaacgttcgcatcggcgagaccctcggaatgagccagcgctacgggagcgtgctcagctacctccgct
tcggtgagggggtctattcgcccctcatcgaagagggcaaggccaacctcatgctcgcccttgagcctgccgaggcttta
aggaacgcgcgctttctcggaaagaacagcgttgccatagtgaacgcctatcccatccacacagcgacgaccctcgtcgg
gaaggagcgctacccggagctcgatgaaatcgaaaaggcgatagggagaatctgccccgtccacatgatgaacttccagc
gcgaggcagacaagataaaccccagaactttgggcgtcctgatgctcggctacgcctacgggaagggcctgatacccctt
aagcgcgagagccttcttgagggaataaggctgaccctccgcgagaagctctgggagatgaacttcagggcctttgagcg
tggggaggaacttgctaaggcc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1939247 - 1940828 (Additional range around tg2042 is :500nt.)

>Thermococcus gammatolerans EJ3 AGAACGTAGTCAAAGGTGTTATCTTCAAAGGGCAACTCTCTGGCGTCGGCTTTGATGAACTCCACCTTCGAGCCCTTCTC TTTGGCAAAACCCCTCGCGAGGGAGAGCATGTACTCGCTGTTGTCAACGCCAACGACGGTAAAGCCCAAATCCTCAAGCA GGAACGAGAAGCCTCCAGCGCCACAGCCGAGGTCGAGGACTTTCCCCTTTTCCTTCATGAACTTCATCAGGAGCGGTTCA AGGTTCTCAATTCTCTTCCTGTACTCGTCGGAATAGATGTCGCTGTAGGCTTTGAATGCGGAGTAGTACTCTTCAAACGT CATGTTTTTGAGTCCTCACGAGTCCTTAAATAGGTATCCCGCTGGTGTCCTCCAAGGGATGGGCATAGTGCAAGCTTGGC GCTGAAAACTTTGGAGATTTTTGGGTTTCTAGAGGTCCTGCCGAATTTTTTTGAGCTTAGCTTTTTATTCTCCCCCTCCA ACTCCCCAAGGTGGTGCTC atggagttcaacctcatcattaccggagtcggcggtcagggaggtcttaccctttcgagg atagtcggaaacgcggccatggtcgagggctacaacgttcgcatcggcgagaccctcggaatgagccagcgctacgggag cgtgctcagctacctccgcttcggtgagggggtctattcgcccctcatcgaagagggcaaggccaacctcatgctcgccc ttgagcctgccgaggctttaaggaacgcgcgctttctcggaaagaacagcgttgccatagtgaacgcctatcccatccac acagcgacgaccctcgtcgggaaggagcgctacccggagctcgatgaaatcgaaaaggcgatagggagaatctgccccgt ccacatgatgaacttccagcgcgaggcagacaagataaaccccagaactttgggcgtcctgatgctcggctacgcctacg ggaagggcctgataccccttaagcgcgagagccttcttgagggaataaggctgaccctccgcgagaagctctgggagatg aacttcagggcctttgagcgtggggaggaacttgctaaggcc TGATTTTCTGGTTTCCAGCCCACTTTCCTCATTCTTT GTTGTGCTTTATGAAGGCGATGTATAATCCGGGCCGTTGCGATGCATTTCATGTCGTTTATGGGGTTATTGAATTAAATA CCTCTCGAAGTTTTTTCTTTTCCTCCTCGCTCATCCTGTTTCTCATCCACCTCTCTTTAAGGTTCAGGTTCTCGTCCTCC AGATCGAGAACGGCCTTTCTGACTCCGCCCCTCGGATTTTTACTGTCGCCCTTTCGGCGTGGGATGACGTGGAGGTGCAG GTGCGGAACTGTTTGGCCCGCCTCCCTTCCGAGGTTCATACCAACGTTAAAGGCATCAGGATTTAGTGCCTTGCGGAGGG CCTTCATGGCCAGCTCCATTCCCTTCAGGAGGGCAGTTTTCTCCTCCTCTCTTAAATCCTCCCATTTCTCAACGTGCCTC CTCGGAACGACGAGAAGATGGCCTTTGCTTGCCGGATAGGAGTCTATGAGGATCCTGATGAGT