tg2046

Coordinates:1943815-1944453

>tg2046 hypothetical protein TGAM_2046
MFILYSPSVKSMLEWFPYTCLAAGFIIIAIAVTRKLGPEWAWINRKIIHFSIVPAILMFYYGKIPVEVFGVSAFIFGVVQ
LWPHLKRHELSWYQIKHNYGEVFFSFSASAVVLLFPREYATALLLAMAISDGVTGVVRHYYFKKNGFNVKLKKHWTGSLA
YLITAIAIGLYLLEGGVVGKLAWATTLMLAEYQPWVDDNLAVPLVGSLLFLLY

>tg2046 hypothetical protein TGAM_2046
ttgttcattctttattcaccctcggtgaaatccatgctggaatggttcccgtatacctgtctcgccgctggcttcataat
catagccatagcagtaaccagaaagctcggacctgaatgggcgtggataaacaggaagataattcacttcagcatcgttc
cggcgattttgatgttctactacggaaaaatcccagttgaagtttttggcgtttccgcctttatcttcggcgtcgttcag
ctttggccccacctcaagagacatgagctgtcttggtaccagataaagcacaactacggcgaggtgttcttttcattctc
ggcctcggcagtcgttctgttgtttcccagagagtacgcaacggccctgctgttggctatggcgatcagcgacggcgtta
ctggagttgtaaggcactactacttcaagaaaaacgggttcaacgtgaagctcaagaagcactggacagggagcttggcc
tacctgataacggccatagcgatagggctttacctccttgaggggggtgttgttggaaaactggcgtgggcgacaacact
aatgctagcggagtaccagccctgggtggacgacaacttggccgttccgctggtgggaagcctgctgttcctcctctac


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1943315 - 1944953 (Additional range around tg2046 is :500nt.)

>Thermococcus gammatolerans EJ3 AGAACAAAGGATTCTACACGGCCTCAAAGGGTTCGAGGGGAAGGATTGAGGTCTACGCCTACAAGGGGAGAACGAGGAAG GACCTCGGGATTCCCCTTTTCGGCTACTCGCTGGGACTTCACGGCTTAACCCTGACGGAGGAGTACCTCATGGAGAAGGC GGAAGAAAACGGCGTCCCCGAGGAGAGACTCCGCTACCTCAAGCTCGGCTTGAGGAAGAGGAAGGAAACTAAGGCCGGCC TTAAGGTCGGAATCGTCTGGGAGAACGGAACGCCCGTTGAGGTCACCCTCAAGCTCTCGACGACTGAACCGAGGGTCAGA ATTCGGGGCCTCTACGGCGAGCTGGTTGGAAAGTCGAGGGGAGAACTGACGAGAACGGACGACTGGTACATCGTGGTTCA TGCGGGAGATTTTATCAGCGCACTCCAGAGTGTGAGGGGAGTGTTCGGTGGAAACGTCTAACGTCGAAGATCCTTTTAGC TTTCACCGAAAGATTTTTAC ttgttcattctttattcaccctcggtgaaatccatgctggaatggttcccgtatacctg tctcgccgctggcttcataatcatagccatagcagtaaccagaaagctcggacctgaatgggcgtggataaacaggaaga taattcacttcagcatcgttccggcgattttgatgttctactacggaaaaatcccagttgaagtttttggcgtttccgcc tttatcttcggcgtcgttcagctttggccccacctcaagagacatgagctgtcttggtaccagataaagcacaactacgg cgaggtgttcttttcattctcggcctcggcagtcgttctgttgtttcccagagagtacgcaacggccctgctgttggcta tggcgatcagcgacggcgttactggagttgtaaggcactactacttcaagaaaaacgggttcaacgtgaagctcaagaag cactggacagggagcttggcctacctgataacggccatagcgatagggctttacctccttgaggggggtgttgttggaaa actggcgtgggcgacaacactaatgctagcggagtaccagccctgggtggacgacaacttggccgttccgctggtgggaa gcctgctgttcctcctctac TGAGCCCACCTGACCTTCAGGCTGTCCTTTTTCACCTTTTTGAACTCCTCAACGAGGGC CCTTCCGGTTCTTTCCATGAACTCCTCAACCTCGGTGATTCTGAGCTCTTTCAGTCCGATTGCCTCCACTCCCTCGGGAA TGCCCTTGGCCTCGACGTTTATCCCGATGTGGATTTTGACGCTCACTGGGGAAACCGTTGCTATCGAGATGCTGAGCTTT CTCCCGTTCACGTAGATGTCGTCTCCCTTTCTAACGGTCTTCACTCCGTACTCGCCGAGAACCTCGCAGAGCCTCGCTAT GAAGAGCTTTTGCAGAGTTGAGGCGAAGAGCGTGTTGACCAAGTCGAAGACCTCGATTATGTAGTGCACCATGTCGTCGC TCCTGATTTCCTTGCTCGCGCGGAGGTCCTCTATGTCAATCATTTCCTCGACCTTGACGTCGCACTTTCCGCGGAAGACG ACGAGCGAGTTTCCAAGGATTCCGAAGTTCCTGTAGGCCC