tg2051

Coordinates:1952348-1952707

>tg2051 hypothetical protein TGAM_2051
MRGLIIRQPYAGWIVEGKKVWEIRKSRTRIRGEVLIISNGKAIGKAELVDVLGPFTPEELAEHGDKHHASLEFLKEYSNG
KPLYAWVFKNATKFERPLEVKLKRGVQVWANVELGEEDEV

>tg2051 hypothetical protein TGAM_2051
ttgagggggcttataatacggcagccctacgctggatggatagttgagggtaaaaaggtctgggagataaggaagtcccg
gacccgcataaggggtgaggtactcataataagcaacggaaaggcgatagggaaggcagagctagttgatgtcctcggcc
ccttcactccggaggagctcgcagaacatggggacaaacatcacgcgagcctggagtttctaaaggagtactccaacgga
aagcctctctacgcttgggtcttcaaaaacgcaacgaagttcgaaagacccttagaagtgaagctcaaaaggggcgttca
ggtctgggccaacgttgagttgggggaggaggatgaggta


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1951848 - 1953207 (Additional range around tg2051 is :500nt.)

>Thermococcus gammatolerans EJ3 ACATCAGGAAAATACTCCCAATCACGGACAGGATAGCGATAACGACGGCTGGGAGCGTTGGTGATGTCCAGGCTCTGGCG AGAATGCTCGAGGCTCAGGCGAGGTATTATCAGTTCACTTGGGGGAGACCTATGACAACGAGGGCTATGGCGAACCTGCT GAGCAACATACTCAACGAGAACAAGTGGTTCCCTTACATGGTGCAGATCATCATAGGTGGCTACGTGGATAAACCGGAAC TGGCGAGCGTTGACGCGCTTGGTGGGCTTGTGTTTGAGAAGTACACTGCCACAGGCTCGGGCAGTCCATTCGCCATTGCG ATAATAGAGGACGGCTACCGTGAGGACATGAGCATAGAGGAGGCCAAAGAGCTGGCTGTGAGGGCCGTCAAAACTGCCGG TAAAAGGGATGTGTACACCGGTGAGAGAAAAGTCCAGGTGGTTGTTATCACCAAGGACGGCATGAAGGAGGAGTTCGTTG AGTTCAAGGAGTGATGACC ttgagggggcttataatacggcagccctacgctggatggatagttgagggtaaaaaggtc tgggagataaggaagtcccggacccgcataaggggtgaggtactcataataagcaacggaaaggcgatagggaaggcaga gctagttgatgtcctcggccccttcactccggaggagctcgcagaacatggggacaaacatcacgcgagcctggagtttc taaaggagtactccaacggaaagcctctctacgcttgggtcttcaaaaacgcaacgaagttcgaaagacccttagaagtg aagctcaaaaggggcgttcaggtctgggccaacgttgagttgggggaggaggatgaggta TAGGTATCTCTTACCCCCA ATAGGCCTTCCCTTCTTTTTCCTGCTTTTTCTCATGTTCGTTGTTTTCTTTACGATATTCTCGGGCATAGTTACAGCTGC TTTTCAGAAACTCGGCATACCTCCGGCCGTTGCCTACACCCTTTTCCTTGCGTCGCTATTTGGGAGTTTCGTTAACATTC CAGTGGCGGAGGAAAGAACATACGTCCCCGTCGTGAAAGTGAGGGAGGTTAGGTTCTTTGGAATTCCTTATCCTGTCCCA TACTTTGATCTTGAAGAGCAGAAGATGATAATCGCTATTAACGTCGGGGGTGCGCTGGTTCCCCTTAGTATCGTCCTCTA CGAGGTTTTGAGATTGGCCTCCATTGGAAGGGTGGATGTGCTCATCAACATGGGGATAGCTGTGGGTATAGCGTCGCTCT TCAGTTACGCCGTTTCCAAGCCTGTCCGGGGTGTGGGCGTAGCCATACCGAGCTTTGTGCCCCCGATCATAGCCGTTATC C