tg2056

Coordinates:1955742-1956245

>tg2056 tRNA-splicing endonuclease (endA)
MIVFYLSGDRVFSTDQNAINGLYNKRHFGKLVEGKLFLSLLEATYLVERGKIEVREGKRKLTVEELMNLGRERDELFDAK
YLVYKDLRDRGYTVKSGLKFGSHFRVYRRGMDEHSQWLVWVLPENSRLSPNDITARVRVAHGVRKNMIMAIVDEDADVTY
YKVEWVRF

>tg2056 tRNA-splicing endonuclease (endA)
atgatagtcttttacctgagcggggacagggtcttttcaaccgaccagaacgcgataaacggcctttacaacaagcgcca
cttcggaaagctggtggagggcaagctcttcctctcgttgctcgaagccacatacctcgtcgagaggggcaagatagagg
tcagggagggaaagagaaaactaaccgtcgaggagctcatgaacctcggaagagagagggacgagctgttcgacgctaag
tacctcgtctacaaggatttgcgcgacaggggctacaccgtcaagtcaggtttaaagttcggctcgcacttccgcgttta
caggcgcggaatggacgagcactcccagtggctcgtgtgggttctcccagagaactcccgcctgagcccgaacgacataa
cggcgagggttagggttgcccatggcgtcaggaagaacatgattatggcgatagttgatgaggacgccgatgttacctac
tacaaggtcgagtgggtgaggttt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1955242 - 1956745 (Additional range around tg2056 is :500nt.)

>Thermococcus gammatolerans EJ3 ATGAGCGTTTCAGTAAAGCAACTGAGCGGAAAGATTCCCCTGGCACTCGTCACGATAAGACCCGCAAGGCTTTTTGATAT AAGTGAGATAATGCGGATCGAGAGGGAGTCCTTCCGCGAGGCCTACCCTAGAGGTCTCTTCCTAGTCTTCCTCGAGAACA ATCCGGAGACGTTTCTCGTTGCAGAATACAACGGCAAGGTAATCGGCTACGTCATGGCCTATCTCAGGCCCGACCTTGAG GGCCACATAATGAGCATAGCCGTCGACGAACGCTACCGGGGGAACGGCATAGGCTCCGCTTTGCTAACCGAGGCGATAAA CAGGCTCATCGCAAGGGGGGCAAGGTACATAGGCCTCGAAGTCCGCGTGAGCAACGAAAAGGCCATAAAGCTCTACGAGC GCTTTGGCTTCCGGAAGGTGAAGCGGATTATCGGCTACTACTCGGACGGCGAAGATGCCTACTACATGCTCCTGCCTGCT GAGGAATGGAGGGGAAGCTG atgatagtcttttacctgagcggggacagggtcttttcaaccgaccagaacgcgataaa cggcctttacaacaagcgccacttcggaaagctggtggagggcaagctcttcctctcgttgctcgaagccacatacctcg tcgagaggggcaagatagaggtcagggagggaaagagaaaactaaccgtcgaggagctcatgaacctcggaagagagagg gacgagctgttcgacgctaagtacctcgtctacaaggatttgcgcgacaggggctacaccgtcaagtcaggtttaaagtt cggctcgcacttccgcgtttacaggcgcggaatggacgagcactcccagtggctcgtgtgggttctcccagagaactccc gcctgagcccgaacgacataacggcgagggttagggttgcccatggcgtcaggaagaacatgattatggcgatagttgat gaggacgccgatgttacctactacaaggtcgagtgggtgaggttt TAGGAGGATGTCCTATGAATGAAACCCTCCTAGT TACCATATTCTTCCTTGCCGGATGGATTTCCTCCGGTGTCCCCTGGCTGATTTTAAGAGCAATGTATCATGTACTCCATC TTAAATCACCTCTTACCGCAAGAGTGCTCTTGACTTTCTTAGGGCTCTCCTTGGCAATCGCCCTAATCGAGTACTCCCCC CTAATAGTTAGCGTGTTTTATAAATCCAGCTTCCTTCTGGTTGGGTTCATAATATCCGCCGTGATCTCACTAATTTTCAG AATCGTCCTCATCCCTGTGCTTGACAATAGGTTGATGGTCAACGCTGGGATTTACGGTCTAAGCGAGGCTCCAGAGAGAA AGAAAGAGCTAATGATAGTTAGTGTTAGCGGATACTTGTTCACATGGATCATCTGGGATTATTTCGATAATACTAACAGC GTTTTTCCTCATTATTTTTGGATACTGGGCTGGAGCGATTTAAATGCCCCTTTAAGAGTTGTGAT