tg2059

Coordinates:1957421-1958260

>tg2059 hypothetical protein TGAM_2059
MITVSESVAYFNVITAIVVLIVMFTLLIMSVKYRREFREHYPRLASAYDWMILAWLGFSLAKFTVLPVELMEGDLLNLSN
STVHQLEALCNIICGVALALLTYGWFHLLKEMLVHYELVPVVELSGDGGTEKMVPGLYIVGVKNGLSLLKKLIGGRAVVI
ISRTPPVFFKNTLGIEKSPVLWLTPIGGKDTVHPRRLEYLTHLLVQFMRRNDAEKVIYLDGVEYLITENGFIPVFKFLAN
IKDHAVISNTVILVPIDPKSIGEKEFRLLTREFEVLSNQS

>tg2059 hypothetical protein TGAM_2059
gtgataacagtgagtgaaagtgtagcttactttaatgtaattacagccatagtagtgctcattgttatgtttacgctctt
aataatgagtgtaaaatacagacgtgagtttagggaacattatccaagactggcaagtgcttacgattggatgattttgg
catggcttggattctctctggcaaagtttactgttctcccggttgaacttatggaaggagacctgctaaatctctctaat
tctacagtgcaccagcttgaagccttgtgtaacatcatctgtggtgttgcactggctctcttgacctatgggtggtttca
tctactcaaggagatgctggtgcactatgagctcgttcccgttgtggagcttagcggagatggaggaaccgagaaaatgg
tacccggactctacatagtaggtgttaaaaacggcttgtcacttcttaagaaactcattggggggagggcagttgttata
atatcaagaacccctccagttttcttcaaaaataccctcgggattgagaaaagtcctgttctctggttgactccaattgg
aggaaaagatacggttcatccccgaagacttgagtatcttacccatcttttagttcagtttatgcgaaggaatgatgcgg
aaaaggtgatataccttgatggggtggaatacctaataaccgaaaatgggtttatccctgtctttaagtttctggcgaac
atcaaggatcatgccgtaataagcaacactgttattctagttccgatagaccccaagtctataggggagaaggaatttag
gctcttgaccagggagtttgaagttttatctaatcagtcc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1956921 - 1958760 (Additional range around tg2059 is :500nt.)

>Thermococcus gammatolerans EJ3 TGAGATTCTCCAGAGGAGCGACGAGCTGGTCAAGAAGCTCTGGGACAACACCCACTTCCTCCAGAACGGGCTGAGAGACC TCGGCTACGACCTCGGAAACACCAAGCACCCGATTACGCCTGTTATGCTCTACGACGAGAAGCTCGCCCAGGAGTTCAGC AGGAGGCTTTACGACGAGTACAACATCTTCGCGCAGGCCATCGTCTATCCGACCGTCCCGCTTGGAACGGCCAGGATAAG GCTCGAGCCGTCAGCGGCCCACAGCAAGGAGGACCTCCAGTACGTCATAGATGCCTTCGAGGATTTGGGGAAGAAGACAG GGTTCTTGAAGTGAGTATTTGTTTCAATCTTTTTTGGGTTTCTTTTCAAATTTTTGAGTTTGGAGATCGTTGAAAATTGG ATAATCGATGATTAGATCCTTTTGATCTTTTATAGAAGGTTTTTTCATCTTTTTTCTCAAAAAGTTTAAATATTCTAATT AAGTATTAACCATATTGGA gtgataacagtgagtgaaagtgtagcttactttaatgtaattacagccatagtagtgctc attgttatgtttacgctcttaataatgagtgtaaaatacagacgtgagtttagggaacattatccaagactggcaagtgc ttacgattggatgattttggcatggcttggattctctctggcaaagtttactgttctcccggttgaacttatggaaggag acctgctaaatctctctaattctacagtgcaccagcttgaagccttgtgtaacatcatctgtggtgttgcactggctctc ttgacctatgggtggtttcatctactcaaggagatgctggtgcactatgagctcgttcccgttgtggagcttagcggaga tggaggaaccgagaaaatggtacccggactctacatagtaggtgttaaaaacggcttgtcacttcttaagaaactcattg gggggagggcagttgttataatatcaagaacccctccagttttcttcaaaaataccctcgggattgagaaaagtcctgtt ctctggttgactccaattggaggaaaagatacggttcatccccgaagacttgagtatcttacccatcttttagttcagtt tatgcgaaggaatgatgcggaaaaggtgatataccttgatggggtggaatacctaataaccgaaaatgggtttatccctg tctttaagtttctggcgaacatcaaggatcatgccgtaataagcaacactgttattctagttccgatagaccccaagtct ataggggagaaggaatttaggctcttgaccagggagtttgaagttttatctaatcagtcc TGACATCTAGTTCTTGCTT AATTTCTTGAATTAGATACAGGAAGTACTTTTTGTAGCCTTTATATCCTGCTTTTTTATTTTCTAAATCAATTATATGAC CGGCAATTTCATTTATTCTTAAAACTGGTTCATGAATTTCATCAATGAATTCTTTTTTCTTTTTTGTGATAAATCCAAGT TTTATTAAAAATCCTACATAGTGATAGCAATTAAATACCTCTTGGATTGCATCATACAAATCAGGGTATTCTTTCTCCAG TTTTTTTAATTCTTCGACTGTTTTTGTTTTAAGAATTATTTCTTTGTTTTGATAGATCATACGACGATATTTTCTAGTTT CTCTTATGTAATCGTACGCTTCTTTCATAACTGCTAGTTCCCGTTGATAACTATTTTCTCGAACTTGAAGAGCAGCATAT ATAACTGAAGCGGCTAGGAGTACTGTTGAAATAGCTTGTAACATGTTGTTATCTACTACTATCATCTCAATCACCGTTTT T