tg2066

Coordinates:1964427-1964765

>tg2066 Nucleotidyltransferase, putative, poly(A) polymerase (PAP) related
MLLTSARLFKVMENEKLKRIMSRLQSHSNELRQLGVKRLWLFGSYVRGDAREDSDLDVLVEFEEGKKTFDNYMELKFLLE
DLLGVEVDLITVEALKPRVRKYVWREAVSVEGL

>tg2066 Nucleotidyltransferase, putative, poly(A) polymerase (PAP) related
atgcttttaacctctgcccggttatttaaagtgatggagaacgaaaaacttaaacgcatcatgagtcgcctgcagagcca
ctctaacgagctgaggcagttaggtgttaaacggctctggctcttcggttcttacgtgaggggtgatgcgagagaggaca
gcgacctcgacgtcctcgtggagtttgaagagggcaagaagaccttcgacaactacatggagctgaagttccttctcgaa
gacctgctcggagtggaagttgacctgataacggtcgaggcgctgaagccgagggtccggaagtacgtatggcgcgaggc
ggtgagcgttgagggacta


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1963927 - 1965265 (Additional range around tg2066 is :500nt.)

>Thermococcus gammatolerans EJ3 CCCGCGAATGAAGGGAGAACGCTATCGGCTGGCCCAGCTGGTGAAAGACGGCGAGAGAATTTTAATTCCCTTCGCCGGAG TTCTGCCCTACGCGCTCGTGATAGCAAGGTATAGAAAGGTCAAGATAACTGCCGTCGAGCTGAACAGGGAAGCCTACGAA CTCGGCCTTGAAAACATAGAGCGCAACAGGAGGAGGCTGAAGGGCGAGATAGAGTTCATTCACGGCGACGCCTTCAAGGT TCTGCCCGAGCTCCCGAGCTACGACCGAGTTATAAGCCCAACGCCGAGGGGCGTTGACGCGCTAAGCTTGACTCTCTCAA AGGCCGAGCGCTGGCTTCACTACTACGACTTCGTTCACGAGAACGAGATTGAAGCATTCAGGCAGAGAATACTTGAGGAA TGCCAAAAGCTTGGAAGGGAGTGCTCCGTGAGGGTGAAGAAGGTGAGCGACTTCAAGCCGCATGTGTTTAAGGTCTGTGC CGACATTGAACTCAGGTGA atgcttttaacctctgcccggttatttaaagtgatggagaacgaaaaacttaaacgcatc atgagtcgcctgcagagccactctaacgagctgaggcagttaggtgttaaacggctctggctcttcggttcttacgtgag gggtgatgcgagagaggacagcgacctcgacgtcctcgtggagtttgaagagggcaagaagaccttcgacaactacatgg agctgaagttccttctcgaagacctgctcggagtggaagttgacctgataacggtcgaggcgctgaagccgagggtccgg aagtacgtatggcgcgaggcggtgagcgttgagggacta TAGAATCTACATTGAGGACATTTTAGAAGCCATAGAGAAA ATCGAGGAGTACACTGATGGGATGACGCTTGAGGAGTTCAGGATAAACAAGATGGTCGTAGATGCCGTCGTGAGAAACCT CGAGATAATCGGAGAAGCGTGCAGGGCAATCCCTCCTGAAATCCGGGAGAAACACCCAGAGGTAGAGTGGCGCAAGATAA TTGGACTGAGAAACATACTAATCCACCAGTACTTCGGAATTGACGTCGAGCTAATCTGGGACCTTATCCAAAACAAGCTC CCGGAACTTAAAGAGAAAATGGAAAGACTATATGAAAGTTTACAAATTCCATAACCATATCAAAAACCTCCACAGCGGGA CGCACTTCACAGTTTTCTCCCCAAACCTCTCCTCGCAGGAACGCCAGCCAGTAACTATTACGCCCTCCTTCAGGCCGAAG ACGTCCATAGCCTCCAAGAGGCCTTCAACTTCCCGCTCCCAGCTCTCGTCGATGTCCCAG