tg2069

Coordinates:1966861-1967613

>tg2069 hypothetical protein TGAM_2069
MKTERVREILARIEGLHREFESKFPLLYEEEGLEGLYRTVKSLYSLSVEKMDLISELYREIAPVSGDVEGILKEVQKSEH
QMKFRLEELLGILSKPDHYSERTRLKASLDRLVHFHRIYDYTMRKALQAIGKEIESIEFLERVGGSENQKKVPTGIVERL
KKIDEIEKALETSLVFMRRLYLHPGDVYRVEEALIRWHRMGLLWVEARNVEKLSGVRNAGEILEGLTLIGVVERKERGGE
SVYRHRSFSSG

>tg2069 hypothetical protein TGAM_2069
atgaagaccgaaagggttcgggaaattctggcaaggatagagggccttcacagggagttcgaatccaagttccccctcct
ttatgaagaggaaggccttgaagggctctatcgcaccgttaaatctctctactcactgtcagtggaaaagatggatctca
tcagcgagctgtaccgtgaaattgcaccggtaagtggagatgttgagggcatcctgaaggaagtccagaaaagcgaacac
cagatgaagttccgccttgaggaactcctcggcattctctcaaagccagaccactattccgaaagaaccagacttaaggc
ctcactcgacaggctcgtacacttccaccgcatatacgactacaccatgaggaaggcacttcaggcaattggaaaggaga
tcgagagcatagagtttctcgagcgggtcgggggaagcgaaaatcagaaaaaggtccccactggtatagttgagagactg
aaaaaaattgacgaaatagagaaagccctcgagacgtccctggtgttcatgaggagactctacctccatcccggggacgt
gtaccgggtcgaggaggctctaatcagatggcacaggatgggactgctgtgggttgaggcgagaaacgttgaaaagctca
gcggcgtcaggaacgccggcgagatccttgaggggctcacgctcattggagtagtggaaaggaaggaacgggggggtgaa
agtgtctacagacacaggagtttcagttcgggt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1966361 - 1968113 (Additional range around tg2069 is :500nt.)

>Thermococcus gammatolerans EJ3 TTTTTTTGTAAACCTCCGGTTTAAGGCTGTGGAGCGAGACGTTGACCCTATTGAGACCGGCCTTCGCAAGGGGCTTTGCC AGCTCCTTTAAGCGACTCCCGTTGGTCGTCATGCTCAGGTCGATCACGTAGGGCTTTATTCTGCGGACGATTTCAAGGAT GTCCTCCCTGACCGTCGGCTCACCGCCAGTAAGCTTGACCTTTCTTATTCCAAGACGAGAGGCTATTCTAACGATTCTCT CTATCTCCTCGGGCGTCATCTCGTTTTTGGCTAAAAACCGCTGGCCCTCGCGGTGGCAGAAAAAGCATCGGAAGTTACAC TCCTGCGTGAGCGAAATCCTGAGGTTCGTTACAGGCCTTCCGAAGCGGTCGTAGAGGGGCATTCAACCACCAAGATGATG AACTCTTCAGCTTAAAAAAACCTTTTGGTTAAATTGAAGTGCTTAACAGGAGAAAAGGTAAAGTAGTTGCAGGAACAAAA TGAGAGCCCGGGGTGAAAAC atgaagaccgaaagggttcgggaaattctggcaaggatagagggccttcacagggagtt cgaatccaagttccccctcctttatgaagaggaaggccttgaagggctctatcgcaccgttaaatctctctactcactgt cagtggaaaagatggatctcatcagcgagctgtaccgtgaaattgcaccggtaagtggagatgttgagggcatcctgaag gaagtccagaaaagcgaacaccagatgaagttccgccttgaggaactcctcggcattctctcaaagccagaccactattc cgaaagaaccagacttaaggcctcactcgacaggctcgtacacttccaccgcatatacgactacaccatgaggaaggcac ttcaggcaattggaaaggagatcgagagcatagagtttctcgagcgggtcgggggaagcgaaaatcagaaaaaggtcccc actggtatagttgagagactgaaaaaaattgacgaaatagagaaagccctcgagacgtccctggtgttcatgaggagact ctacctccatcccggggacgtgtaccgggtcgaggaggctctaatcagatggcacaggatgggactgctgtgggttgagg cgagaaacgttgaaaagctcagcggcgtcaggaacgccggcgagatccttgaggggctcacgctcattggagtagtggaa aggaaggaacgggggggtgaaagtgtctacagacacaggagtttcagttcgggt TAGGGGAATATACAGCACGGCCCTG ACGAAACTCTTCCTCGACAGGGGGTTTAGGATCAGCCAGCCCAGCCAGAAGATAGCCGAAAGGCTCGGGATCGAGAAGAC CTACGACGAGTTCGACGTGGACATCTACGACAAGAGGGATCATCACGGGGTGATTCTCGTCGGTACCGAGGTTGAGAAAG TTAAGGAAGTTTTTGAGGAGGAGTTTATAGACGTCCTCTTCCGGAAGCTTCCGTATCAGCTCTACGGCATTTACAAAGGG CTTGTTATAAAGAGGGACGAACGCTACGTCTACGTCGATATAGGGAACGCGATAGGCACGATTCCGGTGGAGGAGGGAAA AAACCTTCACGAGGGCGACGAGGTCCTTGTCCAGGTCAAGAAGCACAACCTCCTTCCTCACCTGAGCACGATGCTGACGA TCCCCGGTGATTACGCTGTGCTAATACCGAAACCCGTCGGCGTTCAGAGGCACGTCAAGATCTCCCGGAAGATA