tg2079

Coordinates:1974877-1975665

>tg2079 Dioxygenase, putative
MLVGIGMMPHGNPVLEPPDEETERLAEVLRRIGEEFKDADSYVLISPHNVRMSDHLGVVLAENLVSWLGFEGKELPGEWK
TDRELAEEIYEAEKNAGMPVVDLNFASLRGEYSRWPLSWGELIPLQFLERKPLVLMTPSRGVSRKTLVRFGEILSEVLEL
EEKRVALIISADHGHGHSENGPYGKVKESEEYDRLIMKLINEDRLEELLSIPEDLVRKALVDSYWQMLIMLGAMRKAEFE
LKASAYACPTYFGMAGALWVRKS

>tg2079 Dioxygenase, putative
atgctcgtcggaataggcatgatgccccacgggaacccggttcttgagcccccagacgaggaaaccgagaggctcgcgga
agtcctgaggagaatcggtgaggagttcaaagatgcagactcctacgtcctgataagcccgcacaacgtcagaatgagcg
accacctcggcgtcgtccttgctgaaaacctcgtctcgtggctcggcttcgagggaaaggaactgccaggggagtggaag
accgacagagagctggccgaggaaatttacgaggccgagaaaaatgcgggaatgcccgtcgttgacctgaactttgcatc
actccgcggtgagtactctcgctggccgctgagctggggtgagctgatcccgctccagttcctcgaaaggaaaccgctcg
tcctgatgacgccgtcgaggggagttagcaggaaaacgctcgtccgcttcggcgaaatcctcagcgaagtccttgagctg
gaggagaagagggttgcgctgataatcagcgcggatcacgggcacggtcatagcgaaaacggcccctacgggaaggtgaa
ggagagtgaggagtacgacaggctgataatgaagctcatcaacgaagaccgccttgaggagcttctcagcatccccgagg
acctcgttaggaaggccctcgtggacagctactggcagatgttaataatgctcggggcgatgagaaaagcggagttcgag
ttaaaggcgagtgcctatgcctgtccgacatacttcggcatggcaggggcgctgtgggtgagaaaaagc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1974377 - 1976165 (Additional range around tg2079 is :500nt.)

>Thermococcus gammatolerans EJ3 AGATCTGCACGTGGCTCTGGTGCAGGGACATCTGGACTTTAGTCCCAATAAGAATAGAGAACTTCCACGTAACTTCCATA GGTCACTACAGCGGGGAAATACCCGCAGGAATGCCCGTTAGGTACCGGGACAGAAGCGAAAACATAAACTCTTTTGACAT ACTGTTCGATGGATCCTCTGACAACGGAGGGGTTTACTTCACGACCACTATCTCAACGCAGGTCTGCGGTGGAGCCGGCG TTCAGGTGTGCTTTACAGGAAACGTGGACACATACCGTGAAAGTGCCACTGGTTACAGACCTCACTACCACGTAACCATA AACAACTGGGGACATCACACACGGCTCTACTACGCTTACAAGGACGGAAACGGAAGAAACTACTACGAGATCTACCTGAA ATGGGGGCCGGCCGACGATTCAATGCCCCAGCCCCTCACGGCATCCGACAAGGAATGAGAGAATTTTTATTTCGCTTTTC TCACCCTTTTCTGTGGTACC atgctcgtcggaataggcatgatgccccacgggaacccggttcttgagcccccagacga ggaaaccgagaggctcgcggaagtcctgaggagaatcggtgaggagttcaaagatgcagactcctacgtcctgataagcc cgcacaacgtcagaatgagcgaccacctcggcgtcgtccttgctgaaaacctcgtctcgtggctcggcttcgagggaaag gaactgccaggggagtggaagaccgacagagagctggccgaggaaatttacgaggccgagaaaaatgcgggaatgcccgt cgttgacctgaactttgcatcactccgcggtgagtactctcgctggccgctgagctggggtgagctgatcccgctccagt tcctcgaaaggaaaccgctcgtcctgatgacgccgtcgaggggagttagcaggaaaacgctcgtccgcttcggcgaaatc ctcagcgaagtccttgagctggaggagaagagggttgcgctgataatcagcgcggatcacgggcacggtcatagcgaaaa cggcccctacgggaaggtgaaggagagtgaggagtacgacaggctgataatgaagctcatcaacgaagaccgccttgagg agcttctcagcatccccgaggacctcgttaggaaggccctcgtggacagctactggcagatgttaataatgctcggggcg atgagaaaagcggagttcgagttaaaggcgagtgcctatgcctgtccgacatacttcggcatggcaggggcgctgtgggt gagaaaaagc TAAACGACTCCAAAACTAGTCTCCAAAAGCCCCCTGCTCCTCCTGAAGCGAACCTTTCCGATTTTTATC CCCCAATTCCGCCCGTCGTCCTCGTGTGCTCCTTATTGCACGCGTTGACGTTCCAGCCCTCGATGACGACCACCTTGAGG GTTTTAACCTCCTCCGGAACGGGAAACAGGTCGTACATGTCCTCTCCGAAGTGCTTCTCCGCTTCTTCGCGCGGAAGCTC GTAAACCTCAACTGGAGCGTTCTCCTGGACTTTCTCATTGGCGAGGCGCTCTATTTCCTCTACCTCCTCGGGCGTTGGCT TCCGATTGAACTTGACGGTCAGCCTTCCGAAGCTGGAAAAGAAATTCGGAAAGTGCAGGTTTGCAAAGCCAAAAGAGGTC AAAGAACTTACAGGCTACGAGGTCAGTGGCGTTTCTCCCGTCGGCGTGCCGCTCAGGACAATAATTGACCCAAGGGTTCT GGAGAACGAGCACGTCATCGGCGGGGGAGG