tg2087

Coordinates:1979573-1980469

>tg2087 hypothetical protein TGAM_2087
MRTPAVYLAEEVMPYLRAKVAEVLYRGGFRQAEIADYLGVTQAMVSKYLAGRYKRPPGELARKLDELAEEIGRFILYGGT
REEAVVLVSKRLVELFRSGFLCKFYSKYAGISEEACNSIYSDRTGTEVLEELAVALKRLVEMDGFKELIPEVRSNFAYAL
PSPKGPEEVAAVPGRITIAKGKPYALPPEFGASRFTAGILVEVGRLRPEVRSVLNVRYSDRIREALRRLNFRVARVKTEG
MPEDEAIKEIARPFADALYDVVVDEGGHGVEPLVYIFGRDPFDVLKKVELLINELGVRR

>tg2087 hypothetical protein TGAM_2087
atgaggactcccgccgtttatctggcagaagaggtcatgccttatctgcgggcgaaggttgctgaagtcctctatcgagg
gggcttcagacaggctgagattgcggattacttaggagttacccaggcaatggtgagcaagtatctcgccggcaggtaca
aaaggccccctggggagctggcgagaaagctcgatgaactggcggaggaaatcggaaggttcatcctctacggcgggacg
agagaagaagctgtggtcttggtttcaaagcgtctcgtggaactcttcaggagcggttttctctgtaagttctactccaa
gtacgcggggattagcgaggaggcctgcaactccatatactccgacaggactggcacagaagtccttgaggaacttgccg
tcgccctgaagaggctggtggaaatggatggttttaaggagctcatccctgaggtcaggagcaactttgcctatgccctg
ccttctcccaaaggtccggaggaggtggcagcggttccggggaggataacgatagccaaggggaagccctacgcactgcc
tcctgagttcggggccagcaggttcaccgcaggtattctcgttgaggttggcaggcttcgtccggaagtacggagcgttc
tcaacgttcgctacagtgataggatcagggaggccctccggaggcttaacttcagggtcgcacgggtaaaaacagaggga
atgccggaggatgaggcaattaaggagatagccagaccatttgccgatgctctctacgatgtcgttgttgatgaaggcgg
tcacggtgttgagcccctcgtttacatcttcggcagggatcccttcgatgtgctgaaaaaggttgaacttctgattaacg
agctgggggtgagaagg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1979073 - 1980969 (Additional range around tg2087 is :500nt.)

>Thermococcus gammatolerans EJ3 TTGATGACAGGAACCTCCGCCACCTCCGCCGCTAGCCGAGCGGCTCCCTCCATCGGGTGCCTAATCACAATCACGTCGCT GTACTGCTCAACGGTTCTTATCGTGTCGGCCAAGCTTTCGCCCTTCCTGACGCTCGTGCTCGATGCCGAAGAGAAGCCTA TAACAGAGCCGCCGAGCCTGTGCATCGCGCTCTCAAAGCTAAGCCTCGTCCTAGTCGATGGCTCGAAAAAGAGCGTGGCT AAAATTTTCCCCCGCGCGTATTCGAGCGAGCCCTTCTCCCTGAGTTCTTCCTCAAGCCGTTCGGCGACCTTCAAAACGAA CTCGATGTCGCTCTTTGAGAAGTCCCTAATGCTTATAACGTCCCTTCCGTTCCAGTCCATAGGTGCCCTTCTCGTGTAAA ATTCGATGGGTTTTTAAGTCTTTTTTGACATAATTTTGTTCAGTAAAAACCGCAATACCTTTAGGCTATAAGTCGATTAT GCTCTGGCTGGTGATGGTT atgaggactcccgccgtttatctggcagaagaggtcatgccttatctgcgggcgaaggtt gctgaagtcctctatcgagggggcttcagacaggctgagattgcggattacttaggagttacccaggcaatggtgagcaa gtatctcgccggcaggtacaaaaggccccctggggagctggcgagaaagctcgatgaactggcggaggaaatcggaaggt tcatcctctacggcgggacgagagaagaagctgtggtcttggtttcaaagcgtctcgtggaactcttcaggagcggtttt ctctgtaagttctactccaagtacgcggggattagcgaggaggcctgcaactccatatactccgacaggactggcacaga agtccttgaggaacttgccgtcgccctgaagaggctggtggaaatggatggttttaaggagctcatccctgaggtcagga gcaactttgcctatgccctgccttctcccaaaggtccggaggaggtggcagcggttccggggaggataacgatagccaag gggaagccctacgcactgcctcctgagttcggggccagcaggttcaccgcaggtattctcgttgaggttggcaggcttcg tccggaagtacggagcgttctcaacgttcgctacagtgataggatcagggaggccctccggaggcttaacttcagggtcg cacgggtaaaaacagagggaatgccggaggatgaggcaattaaggagatagccagaccatttgccgatgctctctacgat gtcgttgttgatgaaggcggtcacggtgttgagcccctcgtttacatcttcggcagggatcccttcgatgtgctgaaaaa ggttgaacttctgattaacgagctgggggtgagaagg TGATTTACACCCGGGAGCTCCGGTTTTCTACGAGGGGAGAGA TCGACCTCGTGGACATAACGGCCGAGGTTGAAAGGGTCGTCGAGGAGAGCGGAATCGAGAACGGCATTGCTCTCGTTTTC GTGCCCGGGGCTACGGGCGCTATAGTCACGATAGAGCACGAGTCGGGTCTCTTGGAGGACTTCAAGCGCACTCTACGGGA GCTGATACCAAAAGGCGCCGGCTACCTCCACGACAGGATAGATGACAACGCCCACAGCCACCTGCGTGCGACGCTCCTCG GCGCGAGTGAGTGCTTCCCAATCGTTGACGGCAGGCTCGTTCGTGGAACCTGGCAGCAGATTTTCTTCGTCGAACTCGAC GTCAGGCCGAGGCAAAGAAGGGTAATAGTGCAGGTTATGGGGGAGTGAGAACTTCGAGTTCTCACCTAATTTATATACCT TGAAAAGTGTGAGTTCTCAAAACTCATAACGCCCGATGCGAAGGCGTTAAATAGGTTT