tg2089

Coordinates:1981652-1982104

>tg2089 Aspartate carbamoyltransferase, regulatory subunit (pyrI)
MPELKVEVIPEGTVIDHIPAGKWLKVIEILGLTKPNGGTLLIASNVPSKKLGRKDIVKVEGRYLSEEEVNKIALIAPDAT
VNIVRDYKIVEKFKVSIPDEIVGILTCPNPNCVSNHEYVRPRFKVESREPLKLRCHYCERTIEGEEIIGNL

>tg2089 Aspartate carbamoyltransferase, regulatory subunit (pyrI)
atgcccgagctgaaggttgaggtaatccccgaagggacagtcatagaccacattccggccggaaagtggctcaaggtcat
cgaaatccttggattaaccaagccgaacgggggaacgctgctgatagcctcgaacgtccccagcaagaagctcggaagga
aggacatcgtaaaagttgagggaaggtatttgagcgaggaagaggtcaacaagattgccctcatcgcgcctgacgccacc
gttaacatcgtcagggactacaagatagtggagaagttcaaggtctcgattccagacgagatagtgggaatcctcacctg
cccaaatccaaactgcgtcagcaaccacgagtacgtgaggccgcgcttcaaggtcgagagcagggagccgctcaagctcc
gctgccactactgcgagagaacgattgaaggggaagagataatcgggaacctt


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1981152 - 1982604 (Additional range around tg2089 is :500nt.)

>Thermococcus gammatolerans EJ3 ACCAGAGCTCCTGCGGATGCCTAAGCACATCGTCGAGGAGCTCCGCGAGAGGGGCGTTAAGATCCACGAGACGACCGACC TCGAGGGCGCGATTCCAGAGCTTGATGTGCTCTACGTAACGAGAATCCAGCGCGAGCGCTTCCCTGACGAGGAGGAGTAC CTGAAGGTCAAGGGCAGCTACCAGGTGAACTGCAAGCTTTTGAAGAACGCCAAGGAAACGCTAAAGGTCATGCACCCGCT CCCGAGGGTGGACGAGATTCACCCAGAGGTTGACAAGAGCGAGCACGCGCTCTACTTCAGGCAGGTCTTCTCCGGCGTGC CGGTGAGGATGGCTCTTCTGGGTCTAACGCTGGGGGTGCTCTGAATGAAGACAAGTTTGAGGGCGCATCCCCTTCAAAAC TCTGGAGGGGATGCATGGAGAGTTTGGAGTGTTGGTAAGACCCCAAATATTTTCCGCCAGCGCTTTGCGGAGCAAAGGGC TGTTACGGGGGTGCTCTGAA atgcccgagctgaaggttgaggtaatccccgaagggacagtcatagaccacattccggc cggaaagtggctcaaggtcatcgaaatccttggattaaccaagccgaacgggggaacgctgctgatagcctcgaacgtcc ccagcaagaagctcggaaggaaggacatcgtaaaagttgagggaaggtatttgagcgaggaagaggtcaacaagattgcc ctcatcgcgcctgacgccaccgttaacatcgtcagggactacaagatagtggagaagttcaaggtctcgattccagacga gatagtgggaatcctcacctgcccaaatccaaactgcgtcagcaaccacgagtacgtgaggccgcgcttcaaggtcgaga gcagggagccgctcaagctccgctgccactactgcgagagaacgattgaaggggaagagataatcgggaacctt TAGCT TTTTAACCTCCTCGTCTTTTCTATTTCGATGATTCCCCCAACGGTCGAGGACGTATCAAAATTAGTTCGGGAGATAAGGC TTGAGCACGGCCTTCCAGAGAGCCCCTTCAGGATAGACGAGGTTCGCTACGACCCAAGGGGGGACAAGCTCTTCATAATA GCCCACGACAGGACTGACAAGAGCGTTATCATCGGCAACAGCCTCGTCATCGGAAAGCTCCGGGAGAGGCTCGGAGTCAA GCAGGTTACGGTTTACTCAAACCTCGACCTTGAAATTAAGAGGAGAAAGCTCAATGAGGTGGAAAAACTCGTAAAGGGGA CGGAGCTTGGGTTCCTAATGCCGATAATCGAGGCAGAGCGGAGGTTTCCACCGAGGGAATGGCCTGAAGTTAGAGGAAAC CTGAAAACGCTCGTCTTCCTGAGCTTCTCCGCCAAACCACTCCTCGGCTTTGCCAGGGCTCTCAAGCTCCCCTACGAGGC AGTCGGACTGAGAT