tg2099

Coordinates:1988753-1989532

>tg2099 btpA family protein (btpA)
MDFERKPLIGMVHLKPLPGSYLYDGNLEGIIELAVKDAKTLEGAGFDAIMIENFGDVPFPKYVGKTTVAAFTAVAKAVRD
EVSVPVGINVLRNDGIAAYSIAYAIKADFIRVNVLSGVAYTDQGIIEGIAHELAKLRKLLPSKIQIFADVHVKHAVHFFD
FEDAIRDTVERGLADAVVVSGRSTGKPVDLENLALAKRISPVPVIVGSGTTYDNLPELWRYADAFIVGTWLKRDGKVENE
VSPERARKLVELAEKLRKSS

>tg2099 btpA family protein (btpA)
atggacttcgagaggaaaccgctcatcgggatggtccacctcaagccccttcccggctcgtacctctacgacggcaacct
tgaggggatcattgagctcgcggtgaaggacgccaagactctcgaaggggcgggctttgacgcgataatgattgagaact
tcggcgacgtcccgtttccaaagtacgtgggcaaaacaaccgttgcagccttcacagcggtcgccaaggccgtcagggac
gaggtgagcgttccggtcgggattaacgtcctcaggaacgacgggatagccgcgtattcaatagcctacgcgattaaagc
ggacttcataagggttaacgtgctgagcggagttgcttacaccgaccagggaattatagagggcatcgcccacgagctgg
cgaagctcagaaagctcctcccgagcaagattcagatctttgccgacgtccacgtcaagcatgcggttcacttcttcgac
ttcgaggatgcgataagggacaccgtcgagcgcggtctggccgatgcagtggtggtgagcggaaggtcaaccggaaagcc
cgtggatttagagaatctcgccctcgcgaagagaatctcgcccgtgccagtaatagtcggctctggaacaacctacgaca
acctgcccgagctgtggaggtatgcggatgccttcatcgtcggcacgtggctcaagcgcgacggaaaggtcgagaacgag
gtttcccctgagagggccagaaagctcgttgagctggcggagaagctgaggaaaagttct


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1988253 - 1990032 (Additional range around tg2099 is :500nt.)

>Thermococcus gammatolerans EJ3 CCACGTCTCGCTCGTTAACCTCTTTTTGACGTCAATCGACACGGGCTCAACCGCTATCGCGTTTAGGGCATCTTTTATCG CGTTGATGGCCTTCCTTGCCTCTTCTTTGTTCATCCAGCCGAGCTTGAGGCTTATGCTCTCCTCCCCCTCGATCACGAAC TCGGAGCTCATGACGCCGAGCTTAACCGTCACTTGCTCCAGCTTCTGGTAGGGGATCGCCTTGAGGTCGTACCTCCCGAG AACCTTCTCGTCCAGGTAGATTATCCTCCTGTCCGTCACGAGGAGCCACTTCGGCTTCTCAAGGCTTATCTTCTTCTTTA TGGCAAACAGGACCCTCTCCTCCGGCTCCAGATGCCTCCTCACAGATTTTGGAAGTTCGGGGTTCTCCACGACACCCATT TCGTTCACCTACCAGCTTCATTGGGTTATCATCCTATATCACTCTTTCCTTTCCACAGTGCTTATTAACGTCCAGTGCGA ACCTTTAACGGGTGATTCA atggacttcgagaggaaaccgctcatcgggatggtccacctcaagccccttcccggctcg tacctctacgacggcaaccttgaggggatcattgagctcgcggtgaaggacgccaagactctcgaaggggcgggctttga cgcgataatgattgagaacttcggcgacgtcccgtttccaaagtacgtgggcaaaacaaccgttgcagccttcacagcgg tcgccaaggccgtcagggacgaggtgagcgttccggtcgggattaacgtcctcaggaacgacgggatagccgcgtattca atagcctacgcgattaaagcggacttcataagggttaacgtgctgagcggagttgcttacaccgaccagggaattataga gggcatcgcccacgagctggcgaagctcagaaagctcctcccgagcaagattcagatctttgccgacgtccacgtcaagc atgcggttcacttcttcgacttcgaggatgcgataagggacaccgtcgagcgcggtctggccgatgcagtggtggtgagc ggaaggtcaaccggaaagcccgtggatttagagaatctcgccctcgcgaagagaatctcgcccgtgccagtaatagtcgg ctctggaacaacctacgacaacctgcccgagctgtggaggtatgcggatgccttcatcgtcggcacgtggctcaagcgcg acggaaaggtcgagaacgaggtttcccctgagagggccagaaagctcgttgagctggcggagaagctgaggaaaagttct TAGCTTTCCTTCAGAATTCTTCGAATTTTCTTTTCCGAAAGCCTTATTACCCCTGAGCGAGTAAGTTGTAGAAACGGCC CTGTCCCGCTTTTCTCTTCCGCGAGATGGGTTGTTTGGGAGGTGTTGAGTTTGGGAATCCTGAAGAAACTGATGGTTGGC TTCTTCCTGCTCCTCTTCATCGGGGTTGCGGCAATCTTTGGAATGCAGTACTACTACGAAACAGCTTACAACAAGGTTCC GGTCGAGGTCAAGACTGAAACCGTGAGCGGCGACGTCTTCTACCTCAGCCACGTGCTCGAGCCTGGAAAGTACAAGATAA CGGCCGATAGCGAGGGGACAGTCGAGAAGATAACGATACTCGACGAGAACGGTAACGTCTTGACCGAATCCGAGACGGAC AGCTTGATATACGGCTCCAGCGTGCCGTTTCAGGTGAGAGTTGACTACAAAGCTCCGGTTAACGTTGAGAGCTACACGGT CTCGGTCGGCATATACAGGCT