tg2105

Coordinates:1994946-1995593

>tg2105 hypothetical protein TGAM_2105
MGKIESFFSGLKFGETVLVEYPSNSYPELFLKLLHDYASSRGLHVLVDDILDAYPVLVKGLKSMGLPPGETVVIKIGGGR
LEAGTIISRMEVDKYSIPFGHYMNSINKFREANGRYFNPVVGIHRMVTLFSEREMLSLLTTISYFVGDDRRVSFYLINED
VIESSKPVFLPLFEEIATTVTEWYLDGDELVLVVHKAANPELLGKEYRVKVSEFFG

>tg2105 hypothetical protein TGAM_2105
gtggggaagattgagtctttcttctcggggcttaaattcggcgagaccgtgctcgtggagtacccctcgaactcgtatcc
cgagctgttcctcaagctcctccacgactatgcatcctcgagaggccttcacgttctcgttgatgacatcctagacgctt
atcccgttctcgtgaagggccttaagtccatgggtcttccccctggtgagaccgtcgtcataaagatagggggaggcagg
cttgaggcgggtacgataataagcaggatggaggtcgacaagtactccataccctttggccattacatgaattccatcaa
caagttccgcgaggccaacggccgctatttcaatcccgttgttgggatccacaggatggtgacgctcttctccgaaaggg
agatgctgtccctgctcacgacgatctcgtacttcgttggggatgacaggcgggtttctttctacctaataaacgaggac
gtgatcgagagcagcaaacccgttttcctgcccctgtttgaggagatcgccacaacggttacggagtggtacctggacgg
tgatgagctcgtcctcgtcgttcacaaggccgccaatccagaacttcttggaaaggagtacagggtcaaggtttctgaat
tctttggg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1994446 - 1996093 (Additional range around tg2105 is :500nt.)

>Thermococcus gammatolerans EJ3 GCGATCCTGTTCTTCACGTTCTCCCCCCTCAGGAGTTCCGCCGCTTTGCCCGTGACCTCGAGCTTCTCGGAGATGTCCAC ATCATCGAGCCTCTTTTCCCCGAGGTTCGAGACGCTGTCCCTGATAGGATCTCCGAGGTATATTTTTTCCGGCCCCCTTG AGAGCCCGGCCATCTTCATTGCGGTTTTGATTACCTCCTCTGCCTTTGAGAGGTCATTGGCCGATGAGAAGCCCCACCCC TTCTTAAAGGCCCTGACCCCGATCCCCATCTCAACGTTGTTCGAGAGCTCGTCCAGCTGGTCGTTCTGGATGAGAACCGA CGTCGTCTTTACCTTTGAGATCCTTATCTCGAAGTACCCCACGCCCAGTTTATCGGCGGTTCGCTCGGCGATTTTGAACA GGTTATCCTCCATATTCCCACCTCAACCCGATCGGCTGTATCGCTTATAAACGCAACCTTAATAAGTTTGAAGTTCGTCT TTTCTATGGGTGATTCCGG gtggggaagattgagtctttcttctcggggcttaaattcggcgagaccgtgctcgtggag tacccctcgaactcgtatcccgagctgttcctcaagctcctccacgactatgcatcctcgagaggccttcacgttctcgt tgatgacatcctagacgcttatcccgttctcgtgaagggccttaagtccatgggtcttccccctggtgagaccgtcgtca taaagatagggggaggcaggcttgaggcgggtacgataataagcaggatggaggtcgacaagtactccataccctttggc cattacatgaattccatcaacaagttccgcgaggccaacggccgctatttcaatcccgttgttgggatccacaggatggt gacgctcttctccgaaagggagatgctgtccctgctcacgacgatctcgtacttcgttggggatgacaggcgggtttctt tctacctaataaacgaggacgtgatcgagagcagcaaacccgttttcctgcccctgtttgaggagatcgccacaacggtt acggagtggtacctggacggtgatgagctcgtcctcgtcgttcacaaggccgccaatccagaacttcttggaaaggagta cagggtcaaggtttctgaattctttggg TGAATCGCACGGTTTTCATTGTTCCTTTGTGTTCACTTGAGGTCTTCTTGC TGAGCAAACTTTCCAAGTTTTGCACACTATTAAAAGTGATAAGTAAAATTTGAATAGAAAAAAGTTTTAAATACTTTTTT CAGCTTGTATATGACGGATAACTCTATTTAGTGCTCATTTAGATACTGCCTCAAGCTGACTACTATGTCCATGGTGGCGC CGTTATGATCGACCGGGTCAAGTTCAACGACGGCAGCGAGAGTAAGGTTCTCAGCATGGACGCTATCGTCTACACCGGCC CGGGAAGCGTTGAGAGCCCGGAGTTCATCGCTCCCGTTGGAAACGCCCTTCAGGCTTCAGTTTCCGGAATAGTCAAGATC CGCTACCGCTCGGTGACCAGTCCAGGTGGGGACACCCCCAACTCCAAGCCCGGCGATCCTGTTGAGACCACCTCGGTTCA GGCCTACACTCCCGCGGATTACTCCACTCCTACCGCGCCGGTTCTTGTG