tg2110

Coordinates:2000107-2000664

>tg2110 hypothetical protein TGAM_2110
MMIMEVLNRIISRKFRDIAGDRYEQIAKRYREFLLLPEELVLPEVKSILFPVDRFSLDIPEELFETLRAYAGASLKLIYI
SEKRTLHIIEQTLGKEEAEKLKAEKMRFASETLRNLAPRLENLGLSVETDYFIGSKSDDVIELMSTGKFDLLVISRCFGS
EPSRTSPISPVVFKIVQHIDEPVIVY

>tg2110 hypothetical protein TGAM_2110
atgatgatcatggaggtgctcaatcgcataatctcccggaagttcagggacattgccggggatcgctatgagcagatagc
caagcgctaccgtgagttccttctcctcccggaggaactggttcttccggaggtcaaatcgatactgtttcctgtggaca
ggttctcacttgacataccagaagaactttttgagaccctgagggcttatgccggggcctcgttaaagctcatttacatc
tccgagaagagaacccttcacatcatagagcagaccctcgggaaggaggaggccgagaaactgaaggcggagaagatgcg
ctttgccagcgaaacactccgcaaccttgcgcccagacttgagaacctaggcctctcggtcgaaaccgactacttcatcg
ggagcaagagcgacgacgttatagagctcatgtccaccggaaagtttgatctgctggtgatctcccgttgctttggctcc
gagccgagcagaacttccccaataagcccggtggtgtttaaaatcgtccagcacatcgatgagcccgtcatcgtctac


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 1999607 - 2001164 (Additional range around tg2110 is :500nt.)

>Thermococcus gammatolerans EJ3 ACCTTCCAGCCTTCAAGTGCCGCTATTATTCCAACGGTCATAGTTCCTCCGGCGGAGGGGCCGCCTATGATCGGTGAGTC CGCCCTGACCTGTATGAAAACATCATACTTGCTCATGTCCTTCCCAGTGACCTCTCCGGCTATCTGCGTTGCCAGCCTTG CGCTCGCCTGCATGTCAACCTCCGCCAGGGGCCACGTCTCAAGGTACACGTGCCCGCTTCCCGGGGCTACCGTTATTACG AAGTTGGTGGCCACTCCAACGAGCCTTCCATCGGGGGTTCTTGAGACAGCTGGTGCCTTGAGAACAATCGTGTGCCCCTC ACAGGGACATTGGGCCCCCACCGCTGGCAGTATCGAGAAGATGAGTAGCAGTACCGCTGCCAGGGCGTACGTTTTTCTCA TTACTCCTCACCGGGTTTAAGTGAAGTGGTTTTGTTAAATGGATTTCGGTTCGCTGAATTTAGAAAGCCTTAAATTGACC TCGCACTTCTGGAATCTGG atgatgatcatggaggtgctcaatcgcataatctcccggaagttcagggacattgccggg gatcgctatgagcagatagccaagcgctaccgtgagttccttctcctcccggaggaactggttcttccggaggtcaaatc gatactgtttcctgtggacaggttctcacttgacataccagaagaactttttgagaccctgagggcttatgccggggcct cgttaaagctcatttacatctccgagaagagaacccttcacatcatagagcagaccctcgggaaggaggaggccgagaaa ctgaaggcggagaagatgcgctttgccagcgaaacactccgcaaccttgcgcccagacttgagaacctaggcctctcggt cgaaaccgactacttcatcgggagcaagagcgacgacgttatagagctcatgtccaccggaaagtttgatctgctggtga tctcccgttgctttggctccgagccgagcagaacttccccaataagcccggtggtgtttaaaatcgtccagcacatcgat gagcccgtcatcgtctac TGAGTGGAGGTGTCGTAATGGATCCAGCGCTTATAATAGCGGTTTCAGTGTTCCTCTTTAC CTATGCCCTCATAATAAGTGAGAAGGTTCACAGAACCGTTGCAGCCCTCTTTGGAGCCTCTATAGTCCTGTTTTTGCATG TTGTACCGTGGGACAAGCTCCCCGCCTACCTAGATCTGGACACCCTTTTCCTCCTCATAGGGATGATGATCATAGTGAAC ACAGCGAGGGAAAGTGGTCTCTTTGAATACATAGCGATAAAAACCGCGAAACTTGCCAGGGGCAGTCCTATGCGGGTTCT TTTGCTCTTCTCGATTGTTACCGCTGTTGTCAGCTCAATCCTCGACAACGTTACCACAGTTCTCCTGCTCACTCCAATGC TCATCTACATAACCCGCCTCATGAAGGTTGATCCGGTCCCCTTCCTCCTGTCGGAGGTCTTTGCCTCCAACATCGGTGGG ACGGCAACACTGATTGGTGATCCTCCGAACATCATGATA