tg2126

Coordinates:2012767-2013339

>tg2126 Signal peptidase, peptidase S26B
MTLRSKVLSLFSAFFLVVTLLVAVLHFSFGFQYVVVLTDSMKPNINPGDLVVIYPSRDVHPGDVVLYRIELGGTEYRIIH
RVVAIRTDQEGRIYYVTKGDNRKYTDPWRVYPDQVVGKLLFVIPYVGRLYYYLPLIITALILSLMAIIGYELVKILLEEE
EKPSKGPAIVLRRSRDMYMLRRSRRPGRGRF

>tg2126 Signal peptidase, peptidase S26B
atgaccctccgctccaaagtactttctctcttttcagccttttttcttgtcgtgacccttctcgtcgcggttctgcactt
ctccttcggcttccagtacgttgttgttctcaccgattccatgaagccgaatataaaccccggtgacctcgttgttatct
atccatccagagatgtccaccccggggacgttgtcctctaccgcatcgagctcggcggaacagagtaccgtataattcac
agggtcgtcgcaatcaggacggatcaggaggggaggatctactacgtgaccaagggcgacaacaggaagtacaccgatcc
ctggagggtttatccggatcaggttgttggaaagttgctcttcgtgatcccctacgttgggagactttactactacctgc
ccttgataataacggccctgatactgagtctcatggccatcatcgggtatgagctcgttaaaatcctgctggaagaagag
gaaaaaccgtcaaaggggcctgcaatagtcctcaggcgctcccgggatatgtacatgctcagacggtcgaggcggcccgg
gaggggacggttc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 2012267 - 2013839 (Additional range around tg2126 is :500nt.)

>Thermococcus gammatolerans EJ3 CCAGTTTGAGAAAAAACGTTAAATATCAAAAACGCGTAAAATTTCGAGAGGATCCAATCGAGGTGATGAAAGGTGAACAG GAGGCTAAAAAAGGCCCTGCCCCTTCTGGGGGCTCTGGTCTTCCTGATGGTTGGTGCGGCGCTGGCAGTACCAACGTTTA ACCTCCACATCCAGAACATAGGTGAAGGAGGTCCTCAGCAGATTACAGTTCCTGGTGGAGTCGCCAATGCAAACGTCAAC TGGATTCTTGACAGTAATCCAGATTATGTGGCGGGAGTAACGGTCTCCTTCGACCAGAATCTTGACTCCGGAACAACGAT ATACGTTAAGGTTTATGACTCAAGTGAAAATTTGATTGCCCAAGGTAGTCAAACCTTGAACTCCGCCCTTAATTCAGGCA CAGCTGTTGAAATACACTTCAGTAGCAGTGTCGAAATTAAAAACATGGATAAGGTCGCCGTCGTCCTCGTTGGGCCACAG CAGTGATGGAGGCCCCTGA atgaccctccgctccaaagtactttctctcttttcagccttttttcttgtcgtgaccctt ctcgtcgcggttctgcacttctccttcggcttccagtacgttgttgttctcaccgattccatgaagccgaatataaaccc cggtgacctcgttgttatctatccatccagagatgtccaccccggggacgttgtcctctaccgcatcgagctcggcggaa cagagtaccgtataattcacagggtcgtcgcaatcaggacggatcaggaggggaggatctactacgtgaccaagggcgac aacaggaagtacaccgatccctggagggtttatccggatcaggttgttggaaagttgctcttcgtgatcccctacgttgg gagactttactactacctgcccttgataataacggccctgatactgagtctcatggccatcatcgggtatgagctcgtta aaatcctgctggaagaagaggaaaaaccgtcaaaggggcctgcaatagtcctcaggcgctcccgggatatgtacatgctc agacggtcgaggcggcccgggaggggacggttc TGATCACCACTTGTCCTCGGGTATTGCTTCCTTCTTTGCTGGGATC AGGCAGAGGAACTCGAAGGTCTCGCTCAAAGCCTTGTAGCCGTGGGGCTCGTTGGGCGGGACGTAGAGGAAATTTCCGGC CTTGACGTGGTGCTCCTCCTCTCCGTTGGTGATTATCCCTTCTCCCTTCAGGATGAATATCTCATGCTCCCAGTCGTGCT GGTGTATCGGGATCTCCGAGTCCTTTTTGAGGACAAAGTAGCGCATGGCGAAGTTCTTTGCCCCAAGCTTGGGATAAACG AGCCACCTTATCGTTACGCCCTCAAAACCCGTCTCCTCCTCGGGGACCTCAAGGTAGTGTCCGACGAACATGGTATCACC GTTTTAACTTTCTCGGGCTGGTATTTAGACTTTGTGCATACCAAAGCCTTTTAATCCCGGTTCGTTTATCCAATTGGGTG AACTTTCGTGGAAAGAAAGGTGCTGGCGGTGCTCCTTTTGGGAGTTTTCCTTCT