tg2127

Coordinates:2013356-2013766

>tg2127 hypothetical protein TGAM_2127
MNRRLKKALPLLGALVFLMVGAALAVPTFNLHIQNIGEGGPQQITVPGGVANANVNWILDSNPDYVAGVTVSFDQNLDSG
TTIYVKVYDSSENLIAQGSQTLNSALNSGTAVEIHFSSSVEIKNMDKVAVVLVGPQQ

>tg2127 hypothetical protein TGAM_2127
gtgaacaggaggctaaaaaaggccctgccccttctgggggctctggtcttcctgatggttggtgcggcgctggcagtacc
aacgtttaacctccacatccagaacataggtgaaggaggtcctcagcagattacagttcctggtggagtcgccaatgcaa
acgtcaactggattcttgacagtaatccagattatgtggcgggagtaacggtctccttcgaccagaatcttgactccgga
acaacgatatacgttaaggtttatgactcaagtgaaaatttgattgcccaaggtagtcaaaccttgaactccgcccttaa
ttcaggcacagctgttgaaatacacttcagtagcagtgtcgaaattaaaaacatggataaggtcgccgtcgtcctcgttg
ggccacagcag


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 2012856 - 2014266 (Additional range around tg2127 is :500nt.)

>Thermococcus gammatolerans EJ3 CTCCCGCTACTCGGCAAGGCCGGGGACGATAGCGGCAAGGTGGAAGCAGTTGCCCGGCTGGCTCGTCAAGGAGCGTTCCC GCGAGCTTCACAGGCTCCGCCTCGCGATAGCATACGAGATAAACAGGGCCTACGTCGGCAGAACCGTTGAGGTTCTCGTT CACGGTCCGGGCAAGAAGGGTGGAATCGAGGGCAGGACGTTCAACTACAAGGATATAATCCTCGACTCGGGCGAGGCGGG GGGCTTCGTCAGGGTAAAGGTCGAGCGCGCCACCGCGACCTATCTGCTCGGCAAGACCGAATGAATTTTTTACATTCGCT CTTTGGTCATTTGAAAATTATCCCAATACTACCCGGATTTTTTTGAGTTTGTCTAATGCGGTCTGGAGATTGTCCGGGTT TAATTATGCTACTTGGAAATTTTACAACCAGTTTGAGAAAAAACGTTAAATATCAAAAACGCGTAAAATTTCGAGAGGAT CCAATCGAGGTGATGAAAG gtgaacaggaggctaaaaaaggccctgccccttctgggggctctggtcttcctgatggtt ggtgcggcgctggcagtaccaacgtttaacctccacatccagaacataggtgaaggaggtcctcagcagattacagttcc tggtggagtcgccaatgcaaacgtcaactggattcttgacagtaatccagattatgtggcgggagtaacggtctccttcg accagaatcttgactccggaacaacgatatacgttaaggtttatgactcaagtgaaaatttgattgcccaaggtagtcaa accttgaactccgcccttaattcaggcacagctgttgaaatacacttcagtagcagtgtcgaaattaaaaacatggataa ggtcgccgtcgtcctcgttgggccacagcag TGATGGAGGCCCCTGAATGACCCTCCGCTCCAAAGTACTTTCTCTCTT TTCAGCCTTTTTTCTTGTCGTGACCCTTCTCGTCGCGGTTCTGCACTTCTCCTTCGGCTTCCAGTACGTTGTTGTTCTCA CCGATTCCATGAAGCCGAATATAAACCCCGGTGACCTCGTTGTTATCTATCCATCCAGAGATGTCCACCCCGGGGACGTT GTCCTCTACCGCATCGAGCTCGGCGGAACAGAGTACCGTATAATTCACAGGGTCGTCGCAATCAGGACGGATCAGGAGGG GAGGATCTACTACGTGACCAAGGGCGACAACAGGAAGTACACCGATCCCTGGAGGGTTTATCCGGATCAGGTTGTTGGAA AGTTGCTCTTCGTGATCCCCTACGTTGGGAGACTTTACTACTACCTGCCCTTGATAATAACGGCCCTGATACTGAGTCTC ATGGCCATCATCGGGTATGAGCTCGTTAAAATCCTGCTGGAAGAAGAGGAAA