tg2133

Coordinates:2019556-2020179

>tg2133 Phosphatidate cytidylyltransferase (cdsA)
MNTSLKSELKRKALHLTGLVVPALYILTDREFTLTFVATAFAVFVVLEPFRIIEELRDRIKLKLRLINPDVVTGIEVLER
HVMDIEREHERLGVAAHIYFALASLIVVYFFTENVAIAAVTVATLGDAMAAIIGKNFGRHRFSNGKSLEGSLAYFLSALL
VIYPLLGLKLAIAGALIGTLVEFYGLPPDDNFSNQVCVAFALYLFSLI

>tg2133 Phosphatidate cytidylyltransferase (cdsA)
gtgaacacgagcttaaaaagcgagctgaagcgtaaggcccttcacctcaccggtctggtcgtaccggccctctacatcct
cacggatagggagttcaccctcactttcgtagccaccgcctttgcggtattcgttgtcctagagcccttcaggataattg
aggagctcagggacagaataaaactgaagctcaggctgatcaatcctgatgtcgtgactggaattgaggttcttgagcgg
cacgtgatggacatagaaagagagcacgagcgcttgggcgttgcggcccacatatactttgccctcgcctccctcatagt
ggtatacttcttcaccgagaacgtggcgatagcagccgttaccgtcgcaaccctcggcgatgcaatggcggcgataatcg
ggaagaacttcggtaggcacaggttttccaacggtaagagccttgagggcagcctggcatactttctctccgctctgctt
gttatataccccctcctcggtctcaagctcgcgatagccggtgctctcataggcactctcgttgagttctacggcctacc
tccggacgacaacttttcaaaccaggtctgtgtggctttcgcgctctacctcttctccctgatc


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 2019056 - 2020679 (Additional range around tg2133 is :500nt.)

>Thermococcus gammatolerans EJ3 AGGATGGACATTGAAGGTATTATGGAGGAGGTTTTCAGAAGGGTTTATGGAGAAAAAAGAGTCGAAGGGTTCTCAGAGAT ACTGGAACTGGTTGATAAGACGTTTTTCTCCAGTCTTAAACTTTACCCCGACGCGCTTCCCTTTCTAAGAAACCTCAAGG AGATGGGTGCGAGGATCGTCCTGGTTACCGACTCCTCCTCCCGGTGGCAGAGAAGGAAGGTGAAGCACCTCGGAATAGGG GACTATTTCGACGACATAATAATCAGCGGCGAGACCGGTTACTCCAAGCTGACCCCGCACAACTTCAAGCTAGCCCTATC GAGGTTCCCGGACGATGAAGTCTACGTGGTTGGGGACAGGGACGAGACGGACATGGCCGGTGCAAGGGCCATCGGTGCAA CCGGCATACTCGTGAGGAGGGGCTACTTCCGGCGAAAGCATATTAGAAACGCCGATTACATTGTCAGGAACCTGAACGAG GCGCTGGAGGTGATAAAGC gtgaacacgagcttaaaaagcgagctgaagcgtaaggcccttcacctcaccggtctggtc gtaccggccctctacatcctcacggatagggagttcaccctcactttcgtagccaccgcctttgcggtattcgttgtcct agagcccttcaggataattgaggagctcagggacagaataaaactgaagctcaggctgatcaatcctgatgtcgtgactg gaattgaggttcttgagcggcacgtgatggacatagaaagagagcacgagcgcttgggcgttgcggcccacatatacttt gccctcgcctccctcatagtggtatacttcttcaccgagaacgtggcgatagcagccgttaccgtcgcaaccctcggcga tgcaatggcggcgataatcgggaagaacttcggtaggcacaggttttccaacggtaagagccttgagggcagcctggcat actttctctccgctctgcttgttatataccccctcctcggtctcaagctcgcgatagccggtgctctcataggcactctc gttgagttctacggcctacctccggacgacaacttttcaaaccaggtctgtgtggctttcgcgctctacctcttctccct gatc TGAGGGAGCAAAGTATTTATAGCCAAACCACTGTATCACCTTTAGTGATAAGTACGGGTGGTTGCCATGGTCAAG TTTATCTTCGGGATACACAATCACCAGCCCCTCGGAAACTTCGGCTGGGTTTTTGAGAGTGCCTACGAGAGGTCATACAG GCCGTTCATGGAGGCACTTGAGGATTACCCCTCCATGAAGGTAGCCGTCCACTATTCGGGTCCCCTGCTTGAGTGGCTCG TCGAGAACAGGCCAGAGCACATTGACCTTCTCAAAAGCCTCGTCAGGAAAGGGCAGCTTGAGATAGTCGTCGCAGGCTTT TACGAGCCCGTTTTGGCGGCGATACCCAAGGAGGACAGGATAGAGCAGGTTAGACTTCTCAAGGACTTCGCGAAAAAGCT CGGCTACGAGGCAAGGGGCGTGTGGCTGACCGAAAGGGTCTGGCAGCCCGAACTCGTCAAGAGCCTCCGCCAGGCGGGCA TAGAGTACGTCATAGTTGATGACTA