tg2138

Coordinates:2023871-2024479

>tg2138 hypothetical protein TGAM_2138
MVSMKRYIIVGVAALLVFLAGMHLGVSYFSDVAKSSGNEISTGDFDIGISKDGKRFYDDYKLFSFGNLAPGESRTVTFAI
KNRGDYPLSRIVLTFNVTDREDGKLSKAESLVDSTPDVGELSKHLIVKSFVVSDGSKEWSVDSAAGKTLAEINGTPIEIF
TGKLPQNGVLTVNMTLELSPSAGNDCLADSVDVDMSLLAEQQA

>tg2138 hypothetical protein TGAM_2138
gtggtttcaatgaaacgctacataatagttggagttgcggccctgttggtgttcctggccgggatgcacctgggcgtttc
ctacttcagcgacgttgcgaagtccagcggaaacgagatctccacaggcgacttcgacattggcataagcaaggacggca
aaaggttctacgatgactataaactgttctccttcggcaacctcgcgcccggtgagagcaggacggtcacctttgccatt
aaaaaccgcggtgattaccccctctcaaggatcgtactgacattcaacgtcaccgacagagaagacggaaagctatcaaa
ggccgaaagcctcgtggacagcactccggacgttggggagctcagcaaacacctgatcgttaaaagcttcgtcgtctctg
atgggagcaaggaatggagcgttgattccgccgctggcaaaaccctcgcggagatcaacggcacgccgatagagatcttc
accggaaaactgcctcagaacggagtcttgaccgttaacatgaccctagagctctcgccttctgccggaaatgactgcct
ggcggattcggttgatgtcgacatgagcctgctcgcagagcagcaggct


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 2023371 - 2024979 (Additional range around tg2138 is :500nt.)

>Thermococcus gammatolerans EJ3 TCATCAGGACGATAGACATAGCCGTGGAGATAAGATCGTGGAATTTCTCCCTCTTTTTGGTGAGGTAATAAGGGATCTGT CTTGGCATTGCGTTCGGGATCCCCAATGCGGCAACGGTGAGGGTAAGTGTGAGGATTGTGATCGTTAGATTGAAGAGCCC GTAGTCTGAAAGACTAACTCCTCTCGCTATCAATGCCCTGGAAACAAATCCCATAACCAGCGAGAGTGCAGTACCGGTGA TTGTTATCCCCGCCCCCCGAGCAATTTTTTGAAGCGCGGTATTGACTTCACCCATGAAAGCCCCTCCGTCTCCGCCCCAA ACAGCCAGCCCGCGTTTTTTATCAGTCTCGTCTTCAGGGTTTCAGTCATGGCTCCCGGGTTTATTTCCTGATCCCTATTA AAAACTTAAGGTTTTGAGGTGACTTGCTTGAGGTATTACTATTAAAAATCAAAAGCTTTATAAACCAATCCTCGTATCGG CCCATGAGAACTACATTAG gtggtttcaatgaaacgctacataatagttggagttgcggccctgttggtgttcctggcc gggatgcacctgggcgtttcctacttcagcgacgttgcgaagtccagcggaaacgagatctccacaggcgacttcgacat tggcataagcaaggacggcaaaaggttctacgatgactataaactgttctccttcggcaacctcgcgcccggtgagagca ggacggtcacctttgccattaaaaaccgcggtgattaccccctctcaaggatcgtactgacattcaacgtcaccgacaga gaagacggaaagctatcaaaggccgaaagcctcgtggacagcactccggacgttggggagctcagcaaacacctgatcgt taaaagcttcgtcgtctctgatgggagcaaggaatggagcgttgattccgccgctggcaaaaccctcgcggagatcaacg gcacgccgatagagatcttcaccggaaaactgcctcagaacggagtcttgaccgttaacatgaccctagagctctcgcct tctgccggaaatgactgcctggcggattcggttgatgtcgacatgagcctgctcgcagagcagcaggct TAACTTTTTA ATTCTTTTTATCAAATCCAGAACCGCGATGATGAGTGATGGGCGAACCGAACGGTGAGGAAGGAAAGGTGATCGCTGAGC AAGCCTTTTAAGGCCCATCTTCAACCTTTTCTGGGATGATGAGTTCAGCCTTGTCCGAGCCGTGACGAGGGAGTGACGGA CTGACCGCCTCATTTCTTCCAGTGAGTTTAATCTCAAATGTGTCAACAAAAGGTCAAGAAGCACATAGCGGAAATTCCGA AGTCGAGGGGGTAGCCAGCATGGACATCAAGGGTTACGGACTGATTTCACCCTTTTAATATTCACGATAAATACTGCGTT ATTAACCTCGCACAATCTCCTCCAAATCCCTCAAGAACTCCTCGAGGTGCTCCCTCCTCACGTGGGGCATCATGACGATC CTGATGTAGCCCCTGTGCGCGCTGATTCCCCAGCCCCTTCTCTTCAGCTCCTCCTCGACCCGCTCAAGGTTCTCAGTGCC GAAGGAGACA