tg2144

Coordinates:2030917-2031348

>tg2144 hypothetical protein TGAM_2144
MSDLEDTNNKNDEFREGFEDKNLLILTNSYPDEDNRHYGGIFVKKQVRYLARYFNEIYVISPQPYGSNRNLRDYEHDNVR
VYYPRFFHLPVEFFRKRLGDNLTCLAVYLWQYQYEKKLKTFVSNLKRDCCVGKIVTYQGGINSG

>tg2144 hypothetical protein TGAM_2144
gtgagtgatcttgaggatacaaataacaaaaacgatgagttccgagaaggcttcgaggataaaaatctcctaatcctgac
aaattcgtatcccgatgaggacaaccggcactacggcgggatttttgttaagaagcaggtcagatatcttgccaggtatt
ttaatgagatctatgtaatctccccccaaccttatggctctaacaggaacctccgtgattatgagcacgacaacgttaga
gtttactacccgaggttcttccacctgcccgttgagttcttcagaaaacgcctcggtgacaatttaacttgccttgctgt
atatctctggcagtatcaatacgagaaaaaacttaaaacgtttgtatcaaaccttaaaagagactgttgcgttgggaaga
ttgttacctaccaaggggggataaacagtgga


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 2030417 - 2031848 (Additional range around tg2144 is :500nt.)

>Thermococcus gammatolerans EJ3 AAGTTTACAGTGGGATACATTGGGACAATACGAAGTGTTTCAAGCTTTATTCCGCTCTTTGAGGTTGCTCGGAGGGACAG AAGATTGAAATTGCTCTTTGTTGGCTCGGGGGCTTCCAAGGGTAAGATTGCTAACCTTCTAACTGAGAGGTATCCCAACG TTGATGTTGAGTTCATCGATGAGGTTCCCTATCATAATGTCTTCAAGTATTACACCCTCTGCGATGCTGTCTATTCAATG TACCCTCCTACGGATAACATCAAGCGGGCGCTCGCGGTCAAGATGTTTGAGAGCATTGTGATGGGGATTCCTGTGATAGT GAATCGGGACACCTTGATGGAGGATTTCGTAGTTTTGTACCGGTGTGGGGTTTCATCTAATCTCTCAACGGAAGATATGG CGAATGCTTTGGAGAAAATAATAAAAGTAAAGCCACCATCACGTCTTAGGGATAAGTGGAATTGGGATAGGAACAGAAGC ACATTGAGGAGGGTCTATT gtgagtgatcttgaggatacaaataacaaaaacgatgagttccgagaaggcttcgaggat aaaaatctcctaatcctgacaaattcgtatcccgatgaggacaaccggcactacggcgggatttttgttaagaagcaggt cagatatcttgccaggtattttaatgagatctatgtaatctccccccaaccttatggctctaacaggaacctccgtgatt atgagcacgacaacgttagagtttactacccgaggttcttccacctgcccgttgagttcttcagaaaacgcctcggtgac aatttaacttgccttgctgtatatctctggcagtatcaatacgagaaaaaacttaaaacgtttgtatcaaaccttaaaag agactgttgcgttgggaagattgttacctaccaaggggggataaacagtgga TGATGTTAAAATTTTTTTGAGGTATAA TTATGGATTTAGATGGTATAATAAAAATGGTGTTTATGTTAAGGGGTATTTAATTTTTGGAAACGAAGTTTATGAAGGTA AAAATCTAATTGAACTTATTATGGGCATCAATGACTATACTGAACTTGTTGAGTTATTGAAAAATGCGTTTGGGGTATTC TCAATGATTATTACACTTGAAGATGGTGTTCTTCTAGCAGGTGACATTACAAGAACCTTTCCAATTTTTTACCATGTTTC AGATAAAAGTGGGATTGTTGTGTCAGATGATGCATTTTACTTGAGAGATATCTTGCAACTAACTCCGAGATATGATTCGG TTATTGAGTTTTTAAGGGGTTTGTATGTTACGGGGAGAGATACGCTTTTAGATGGTCTGTACCAAGTTCAGGCAGGTGAG ATAGTTTATATAACCTTAGATGGACACGTCAAGTCCCAATTTTATCATCTTTATACTGTATCCTCAGGGGACA