tg2148

Coordinates:2034679-2035590

>tg2148 Glycosyltransferase, family 2
MSRPTVSVIIPTYNRANLLRRAITSVLNQTFRDFELIVVDDASPDNTPEVVESINDGRIRYVRLKKNSGGPVARNTGIKK
ARGKFIALLDDDDEWLPHRLETQVRKFETLEQNIGVVYGGFYYVSQQDGRILGKRLPAYKGNVYDKLLRENFIGSPTLLI
RRECFKRAGLFDPNLSSSQDWDMWLRIARHYKFDYVDEIVAKYYVHGRQISFNMKKYIPGRERFIRKHLDIWKNPRILSI
HLSQMGLLLLLSGEPEKGLRYLMYSIGMAPFNIENYQTLLKLALDSRALEYIRKIISGEDVHKG

>tg2148 Glycosyltransferase, family 2
atgagtaggccaacggtctctgtcatcataccaacgtacaacagggcaaacctgctcagaagggctataaccagcgttct
caatcagacattcagggatttcgaactgatagtggtcgacgatgcatctccagacaacacaccggaagtcgttgagagca
taaacgatggaagaatccggtatgtgcgcctcaaaaagaactctggcggcccggttgccaggaacacaggaataaaaaaa
gccagaggaaagttcatagccctcctggacgacgatgacgagtggctcccccacaggcttgagacccaagtcaggaagtt
cgagactttagaacagaacattggagtcgtatacggaggattctactacgtatcccaacaggatggtaggatactcggaa
agagactacctgcgtataagggaaatgtgtacgataaactcctcagggagaatttcattggcagtccaacactgctgata
aggagggagtgcttcaagagggcggggctttttgatccgaacctctcaagttctcaggactgggacatgtggctgaggat
agcaaggcactacaaatttgactacgtagatgaaatagttgcaaagtactacgttcacggcaggcagatttcgttcaaca
tgaagaagtacatccccggaagggaacgcttcattcgaaagcatcttgacatctggaaaaatccgaggattttgagcatt
cacctgagccaaatgggactgttgctcctcttaagtggcgagcccgagaagggacttcgatacctcatgtattccattgg
gatggcacccttcaacatagaaaattaccagactctactaaagcttgcgctggattcccgcgctttagaatacattcgaa
aaataatctcgggggaagatgtgcataaagga


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 2034179 - 2036090 (Additional range around tg2148 is :500nt.)

>Thermococcus gammatolerans EJ3 CTTTGCTGTCCTCCTTGGAGACGACATCATAGTAAGCGAAAAGCCCGGGATAAAGCAGCTCATCGAGATAGCCGAGCGGA GAGAAGCTCCAGTAATAGGAGTGGAGCGCGTTCCCTGGGAACTTGTAAGCCGGTACGGAATCGTGGACGGGGAACCCTTG GGCGATGGAGTTTACCAAGTGAAACACCTCGTGGAGAAGCCCTCCCCCCAAGAGGCCCCGAGCAACGTTGCAATAATCGG GAGGTACGTCCTGACACCTGAGGTATTCGACGCCCTGAGAGAAACTCCTCCGGGGAGGGGTGGCGAGTTACAGCTCACGG ACGCCCTCCAGGAACTTCTATCTAGCCAGAACATCTTCGCTAAGGAGATAAAAGGCGAGAGATATGACGTTGGAAGTAAG CTTGGGTTCGTCATAGCGAACATTGAACTGAGCCTAAAGAGAGGGGAACTGAGAGAGGAGTTGCTAACCTTCCTCAAAAA TCTCCTAAGGGAGGTCTCAG atgagtaggccaacggtctctgtcatcataccaacgtacaacagggcaaacctgctcag aagggctataaccagcgttctcaatcagacattcagggatttcgaactgatagtggtcgacgatgcatctccagacaaca caccggaagtcgttgagagcataaacgatggaagaatccggtatgtgcgcctcaaaaagaactctggcggcccggttgcc aggaacacaggaataaaaaaagccagaggaaagttcatagccctcctggacgacgatgacgagtggctcccccacaggct tgagacccaagtcaggaagttcgagactttagaacagaacattggagtcgtatacggaggattctactacgtatcccaac aggatggtaggatactcggaaagagactacctgcgtataagggaaatgtgtacgataaactcctcagggagaatttcatt ggcagtccaacactgctgataaggagggagtgcttcaagagggcggggctttttgatccgaacctctcaagttctcagga ctgggacatgtggctgaggatagcaaggcactacaaatttgactacgtagatgaaatagttgcaaagtactacgttcacg gcaggcagatttcgttcaacatgaagaagtacatccccggaagggaacgcttcattcgaaagcatcttgacatctggaaa aatccgaggattttgagcattcacctgagccaaatgggactgttgctcctcttaagtggcgagcccgagaagggacttcg atacctcatgtattccattgggatggcacccttcaacatagaaaattaccagactctactaaagcttgcgctggattccc gcgctttagaatacattcgaaaaataatctcgggggaagatgtgcataaagga TAGCAATTCTTATATTAATCCAACTT CAAGGCTTAGTGGAGGTTGGTCTCAATGTCAGAGGAGGCTAAAAAATATTTCGTTCACCCCCTCGCGGTTGTCGAGGAGG GGGCCGAGATCGGCGAGGGAACGAGGATATGGCACTTCGCACACGTAAGAAAGGGAGCAAAAATAGGAAAGAACTGCAAC ATCGGAAAGGACGTTTACATCGACGTTGACGTCGAGATAGGCAACAACGTAAAAATCCAGAACGGTGTGAGCGTTTATCA CGGGGTTAAAGTCGAAGACGACGTTTTTCTCGGCCCGCACATGACCTTCACCAACGACCTCTACCCAAGGGCCTTCAACG ACGACTGGGAAGTTGTTCCAACCCTCGTCAAAAAGGGCGCTAGCATAGGGGCCCACGCGACGATAGTCTGCGGCGTGACA ATCGGGGAATACGCTATGGTTGGGGCCGGAGCCGTCGTTACAAAGGACGTCCCACCCTTCGGGCTCGTCTACG