tg2149

Coordinates:2035642-2036253

>tg2149 Acetyl/acyl transferase related protein
MSEEAKKYFVHPLAVVEEGAEIGEGTRIWHFAHVRKGAKIGKNCNIGKDVYIDVDVEIGNNVKIQNGVSVYHGVKVEDDV
FLGPHMTFTNDLYPRAFNDDWEVVPTLVKKGASIGAHATIVCGVTIGEYAMVGAGAVVTKDVPPFGLVYGNPARLKGFVC
YCGRKLKEKIGEDDEHIIFKCSHCGREVKIRKKDYERYLKEKDL

>tg2149 Acetyl/acyl transferase related protein
atgtcagaggaggctaaaaaatatttcgttcaccccctcgcggttgtcgaggagggggccgagatcggcgagggaacgag
gatatggcacttcgcacacgtaagaaagggagcaaaaataggaaagaactgcaacatcggaaaggacgtttacatcgacg
ttgacgtcgagataggcaacaacgtaaaaatccagaacggtgtgagcgtttatcacggggttaaagtcgaagacgacgtt
tttctcggcccgcacatgaccttcaccaacgacctctacccaagggccttcaacgacgactgggaagttgttccaaccct
cgtcaaaaagggcgctagcataggggcccacgcgacgatagtctgcggcgtgacaatcggggaatacgctatggttgggg
ccggagccgtcgttacaaaggacgtcccacccttcgggctcgtctacggaaaccccgcccggctgaagggattcgtctgc
tactgcgggaggaagctgaaggaaaaaatcggcgaagatgatgaacacataatattcaagtgctcccactgcggaaggga
ggttaaaatcaggaagaaagactacgaacgctaccttaaggaaaaagacctg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 2035142 - 2036753 (Additional range around tg2149 is :500nt.)

>Thermococcus gammatolerans EJ3 GTCCAACACTGCTGATAAGGAGGGAGTGCTTCAAGAGGGCGGGGCTTTTTGATCCGAACCTCTCAAGTTCTCAGGACTGG GACATGTGGCTGAGGATAGCAAGGCACTACAAATTTGACTACGTAGATGAAATAGTTGCAAAGTACTACGTTCACGGCAG GCAGATTTCGTTCAACATGAAGAAGTACATCCCCGGAAGGGAACGCTTCATTCGAAAGCATCTTGACATCTGGAAAAATC CGAGGATTTTGAGCATTCACCTGAGCCAAATGGGACTGTTGCTCCTCTTAAGTGGCGAGCCCGAGAAGGGACTTCGATAC CTCATGTATTCCATTGGGATGGCACCCTTCAACATAGAAAATTACCAGACTCTACTAAAGCTTGCGCTGGATTCCCGCGC TTTAGAATACATTCGAAAAATAATCTCGGGGGAAGATGTGCATAAAGGATAGCAATTCTTATATTAATCCAACTTCAAGG CTTAGTGGAGGTTGGTCTCA atgtcagaggaggctaaaaaatatttcgttcaccccctcgcggttgtcgaggagggggc cgagatcggcgagggaacgaggatatggcacttcgcacacgtaagaaagggagcaaaaataggaaagaactgcaacatcg gaaaggacgtttacatcgacgttgacgtcgagataggcaacaacgtaaaaatccagaacggtgtgagcgtttatcacggg gttaaagtcgaagacgacgtttttctcggcccgcacatgaccttcaccaacgacctctacccaagggccttcaacgacga ctgggaagttgttccaaccctcgtcaaaaagggcgctagcataggggcccacgcgacgatagtctgcggcgtgacaatcg gggaatacgctatggttggggccggagccgtcgttacaaaggacgtcccacccttcgggctcgtctacggaaaccccgcc cggctgaagggattcgtctgctactgcgggaggaagctgaaggaaaaaatcggcgaagatgatgaacacataatattcaa gtgctcccactgcggaagggaggttaaaatcaggaagaaagactacgaacgctaccttaaggaaaaagacctg TGAGGC GGTGAAAATGAGGAAGGTACCAATAGCCAAGCCCCTTATAGGGGATGAGGAAATAAAAGCTGTTGTTGATGTCCTGAAGA GCGGAATGCTCGCCCACGGAAAGGAGGTCGAGGCCTTCGAGAGAGAGTTTGCCGAGTACCTCGGCGCCAAACACGGCGTA GCCGTCGCCAACGGAACCGCAGCTTTGGACGTCGCCCTCAAGGCCCTCAAAATAGGGGAGGGCGATGAGGTCATAACGAC CCCGTTCACGTTCATAGCCTCCGCTACCTCAATCCTCTTCCAGAGGGCAAAACCGGTTTTCGCCGACATCGACCCCAAAA CCTACAACCTCGACCCGAACGAGGTTCTCGAAAAGATAACGGACAAGACCAGAGCAATACTCGTCGTCCACCTCTACGGC CAGCCTGCGGATATGAAGGCCTTCAAAGAGATAGCAGAGGATCACAACCTCTACCTCATCGAGGACTGCGCCCAGGCTCA CGGTGCCCAGTTT