tg2155

Coordinates:2043371-2044102

>tg2155 N-acetylglucosaminylphosphatidylinositol deacetylase, putative (Pigl)
MYEDYYNTQYSSAVHRNDRTHIPRKHCNKVHGGNIMRVLFLSPHTDDVELGAGGTLVKFLELGHEILWVVFSTAEESLPD
NMPKDTLKREFLGVINDLGLKGENYRILNFHVRRLHEYRQEILEELVKIRKEFAPDLVIGPSLNDYHQDHQVVAWEMTRA
FKNTSSIICYELPWNHVTFNTQLFIKLEEKHVKKKVELLSNYESQLLLNRPYFSKDFIFGWARMRGVQVKAEFAEAFEVI
RWIL

>tg2155 N-acetylglucosaminylphosphatidylinositol deacetylase, putative (Pigl)
atgtatgaagattattacaacactcagtattcatctgcagttcatcgaaatgaccgtactcatatcccaagaaagcactg
caataaggttcatggggggaacataatgagagtcctcttcctctccccccacacggatgatgttgagctgggggccggcg
ggactttggtgaagttcctggaactcggtcacgaaatactctgggtggtgttctccactgctgaggaatccctgccagac
aacatgccaaaggacacgttaaaaagggaattcctgggagtaataaacgatctgggtctaaaaggggagaactacaggat
actgaactttcatgtcaggaggttacatgaatacaggcaggagattcttgaggagttagtgaaaatcaggaaagagtttg
caccggatttggtcattggtccctcgcttaacgactaccaccaggatcatcaggttgtggcgtgggagatgacccgagcg
ttcaagaacacgtcctcaataatctgttacgagcttccttggaaccatgtgacgtttaacactcagctcttcatcaagct
ggaggaaaagcacgttaaaaagaaggtcgagctcttaagtaattatgagagccagctcctccttaacagaccatactttt
caaaggattttatcttcggatgggcaaggatgaggggagtccaggttaaggcggaatttgctgaagcctttgaggtgata
agatggatactg


Thermococcus gammatolerans EJ3

Sequence spaning coordinates : 2042871 - 2044602 (Additional range around tg2155 is :500nt.)

>Thermococcus gammatolerans EJ3 TTGGGCAAAAAGGCATTAGAAACAGAGTTAATTTTGTAAAAGAACTTGAAAAATACGGTCAGGTGTTTATATCTGCAGAG GGGAAATTAGAGAGGGAATTAGAGAAATATAGAGTGAAAATACCTCCTGAACGAATGCATGATCTTTTATATTATGCTAC TCTGTACGTTGGTGAGGGAGGAACTACTGCAAGTGAAGCGGCAACTCTCGGAACACACTCTATTCATATATCTACTACCG CCAAATACTGTGGGGTTTTTTATGACATAAACAGATATGGACTTCTATGGATTTCTGAAGATGAGCGTAGTAGTATAGAA TTAACAAAGACTCTCCTAGGTGAGAACGATTTATGGGGAAGAGGAAAGAAAAAAAGAAAGAAATTAATTAAAAGCAAAAT TAATCTAACCCCCTTTATGGTCTGGTTTATAGAGAACTATCCAAATAGCTTAAAAGAATTTAAAGAAAATCCCAAGATAC AATACAAGTTTAGGTGACGA atgtatgaagattattacaacactcagtattcatctgcagttcatcgaaatgaccgtac tcatatcccaagaaagcactgcaataaggttcatggggggaacataatgagagtcctcttcctctccccccacacggatg atgttgagctgggggccggcgggactttggtgaagttcctggaactcggtcacgaaatactctgggtggtgttctccact gctgaggaatccctgccagacaacatgccaaaggacacgttaaaaagggaattcctgggagtaataaacgatctgggtct aaaaggggagaactacaggatactgaactttcatgtcaggaggttacatgaatacaggcaggagattcttgaggagttag tgaaaatcaggaaagagtttgcaccggatttggtcattggtccctcgcttaacgactaccaccaggatcatcaggttgtg gcgtgggagatgacccgagcgttcaagaacacgtcctcaataatctgttacgagcttccttggaaccatgtgacgtttaa cactcagctcttcatcaagctggaggaaaagcacgttaaaaagaaggtcgagctcttaagtaattatgagagccagctcc tccttaacagaccatacttttcaaaggattttatcttcggatgggcaaggatgaggggagtccaggttaaggcggaattt gctgaagcctttgaggtgataagatggatactg TAAGGGTTCTAATCACTGGCGCTGGTGCACCCGGGATTAGAGGAAC ACTTTACTCTCTGAAAAGCAACTGGGACAACAGGAAAATCACAACAATCGGAGTTGACATGAAGGGAGAAGTCGTCGGGA AGTACCTGTGTGACAGATTTTATCAAGTTCCTCCCGCCAGTAGCGAGGAATTCATCCCCACTCTGTTGGACATTTGTGAG AGAGAGGAAGTTGACGTGGTTCTTCCTCAAGTAACGGCTGAACTTTATCCCCTGGCAAGATACAAAGAAGATTTCGAGAA AATTGGCACGAAAGTGGCCGTTTCCGGCTATGAAGCTATAGAGCTTGCCAACAGCAAAAAGGAACTCATGAAAATTGCCA AGAAAGTTGGCGTCCCTTATCCTGAGTTTTATGTAGTTCGAACGTGGGATGAACTGGAAAGCTCTGCCGAAAAGCTGGGA TTTCCGTTTGTGGTTAAACCGCCGGTTGCAAGTGGAATGAGGGGATTCAGAAT