Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Thermococcus gammatolerans EJ3
>tg0310 Alanyl-tRNA synthetase (alaS)
MGMDMTTRMFKEEGWVRKKCPKCGKYFWTLDPDRETCGDPPCDEYGFIGKPGIPKKYTLDEMREKFLSFFEKHGHGRVKR
YPVLPRWRDDVLLVGASIMDFQPWVISGEADPPANPLTISQPSIRFTDIDNVGITGRHFTIFEMMAHHAFNYPGKPIYWM
DETVELAFEFFTKELKMKPEDITFKENPWAGGGNAGPAFEVLYRGLEVATLVFMQYKKAPENADPSQVVEIKGDYYVPME
TKVVDTGYGLERLVWMSHGTPTAYDAVLGYVIEPLKKMAGVEKIDERILMENSRLAGMFDIEDMGDLRYLREQVAKRVGI
TVEELEKAVRPYELIYAIADHTKALTFMLADGVIPSNVKAGYLARLLIRKSIRHLRELGLEVPLAEIVAMHIKELSPTFP
EFKEMEDVILDIINVEEKRYHETLKRGSDLVRREIAKLKKKGINELPLEKLILFYESHGLTPEIVAEVAQKEGIKVEIPD
NFYTLVAKQAEKTEKKTVAEYVVDFELVKDLPETRTLYYEDPFMKEFDAEVVKVIDDWVVLNQTAFYPEGGGQPYDTGTL
EVDGEEVRVTNVQKVGKVILHRVDKPELFKKGAKVHGKLDWDRRIQHMRHHTGTHVLMGALVRVLGKHVWQAGSQLHTDW
ARLDISHYKRITEEELREIERLANRVVMENRKVTWEWLPRTEAEMKYGFRLYQGGVVPGRTIRVVKIEDWDVQACGGTHL
PNTGLIGPIKILRTERIQDGVERIIFAAGEAAIDWMQETERLLKKTAEIFRVPPEKVPETAERFFNEWKEARKEVEKLRK
ELAKLLVYELENKVEKVGDIEFIGAVVEGTMNDLREAANRLRKEKRVVVLISREGHFVVAVGDGLDLKAGELAKIITSVA
GGGGGGRKELAQGRIKNPLKAEEAIEEVKRRLG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 239909921 Gene name: alaS COG: J COG0013 Alanyl-tRNA synthetase Taxon: 593117 Lineage: Archaea: Euryarchaeota: Thermococci: Thermococcales: Thermococcaceae: Thermococcus: Thermococcus gammatolerans: Thermococcus gammatolerans EJ3
__________