Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Thermococcus gammatolerans EJ3
>tg0926 Peptidase U62, modulator of DNA gyrase, PmbA/TldD protein-like protein (tldD/pmbA)
MAEVVTMENLIRYAEKLFDEVEIAVYRSREVSASVELNEISMASTRSGAVTIIRGIKDKRLGLAIVDSDEEKRVKEAIEQ
AAKMARLNSRDEKWLSLPEPGKYREAPKPNYELKEASPDVLVEMLVRAIKLAREKEPNAVVAGGEGGVSWEERHVVNSHG
IDVFQEGGAAFFFVELVGRKEGVVTPGIFDFDAKRDLNLDVEGVVEKAVQKVKWAYSVKPSRNEEVPIILGPWAIAGLFS
YALLPAFSGERLVKETTPLAGKVGEKIASDVLTMYDDPFHELSLEPVIADGEGVPTRKNVLIENGTFRGFVWDNYWAKVY
GTESTGNGKRDLRSGGINIGFHNVVIEKGKRSLEDMIAEIDRGYFVDGFQGAHSSNPDNGNFAVTANPAFLIEDGEVVGS
SVFLIAGNVYELLRQASEVSREQTVMPFMNTMTTPFIRFENVRIAGK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 239910537 Gene name: tldD COG: R COG0312 Predicted Zn-dependent proteases and their inactivated homologs Taxon: 593117 Lineage: Archaea: Euryarchaeota: Thermococci: Thermococcales: Thermococcaceae: Thermococcus: Thermococcus gammatolerans: Thermococcus gammatolerans EJ3
__________