Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Thermococcus gammatolerans EJ3
>tg1069 Peptidase C56, intracellular protease PfpI family (PfpI)
MKVLFLSANDFEDVELIYPLHRIREEGHEVYIASFERGRITGKHGYSVEVHLRFDEVDPDEFDALVLPGGRAPERIRLNE
KAVAIAKKMFEDGKPVATICHGPQILISAGVLKGRKGTSYAGIKDDMINAGVKWVDEPVVVDGNWVSSRHPEDLYAWMRE
FVRLLR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 239910680 Gene name: pfpI COG: R COG0693 Putative intracellular protease/amidase Taxon: 593117 Lineage: Archaea: Euryarchaeota: Thermococci: Thermococcales: Thermococcaceae: Thermococcus: Thermococcus gammatolerans: Thermococcus gammatolerans EJ3
__________