Similarity searches are performed with RPS-BLAST (BLAST 2.2.x NCBI, Altschul et al., 1997, Nucleic Acids Res. 25:3389-3402) Submit your sequence and select the CDD DataBase you want to match.
Genomapper BLAST psiBLAST Mulalbla Multalin Genes & Genomes BLAST (restricted) Genome Guts COG Guess INTERPROScan CDD search Pattern search Sequence Patterns COG Trees Genome Syntenizer
>tg1131 hypothetical protein TGAM_1131 MRIVSADTGGALLTEDYEPIGLIATAAVLVEKPYRTATLSRVKYADPFDYDMSGRQAIRDEALLAVELAREVRPDIIHLD STIGGIEVRKLDEPTIDALTITDRGKEVWKDLAKDLQPLAKKFWEETGIEIIAIGKSSVPVRIAEIYAGLYTAKWAIDYA RKEGKAIVGLPRYMEVEIRPGKIYGESLDPREGGLFGEIEADTEGIGWELYPNPLVRRFMVLEVWRE
Display full alignements in /Graphics Before submission you must select at least one Conserved Domain DataBase . Pairwise Master-slave with identities Master-slave no identities Flat master-slave Flat master-slave, no identities Master-slave no identities & blunt ends Flat master-slave, no identities & blunt ends Output Alignment: (options not available with blastx and tblastx)
Expect value (E)
[Real]
Query sequence type
Protein Nucleic
Filter query sequence (DUST with blastn, SEG with others)
True False
X dropoff value for gapped alignment (in bits)
[Integer]
Number of one-line descriptions (V)
Number of alignments to show (B)
DataBase administrator