BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0003 1882 2190 103 !not a gene! (103 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A71218 hypothetical protein PH0004 - Pyrococcus horikoshii ... 168 2e-41 emb|CAB44711.1| (AJ242955) hypothetical protein (P4(21)n) [Mus m... 70 7e-12 >pir||A71218 hypothetical protein PH0004 - Pyrococcus horikoshii >gi|3256389|dbj|BAA29072.1| (AP000001) 103aa long hypothetical protein [Pyrococcus horikoshii] Length = 103 Score = 168 bits (420), Expect = 2e-41 Identities = 87/103 (84%), Positives = 92/103 (88%) Query: 1 MSEALASLLRPYSAFLALLIPSIVKGSVTTETVKAPIFFAISAMTGAAPVPVPPPRPHVT 60 MSEA ASLLRPYSAFLALLIPSIV GSVTTETV+APIF AISA+TGAAPVPVPPPRP VT Sbjct: 1 MSEAFASLLRPYSAFLALLIPSIVNGSVTTETVRAPIFLAISAITGAAPVPVPPPRPQVT 60 Query: 61 KTISAPSKASLSSLSLSLAASSPIFGSFPAPRPLVNSLPMRIF 103 KT+SAPS+ASL SLSLS AASSPI GS PAP PLV SLP+ IF Sbjct: 61 KTMSAPSRASLISLSLSFAASSPILGSLPAPSPLVISLPISIF 103 >emb|CAB44711.1| (AJ242955) hypothetical protein (P4(21)n) [Mus musculus] >gi|5103287|dbj|BAA78905.1| (AB028868) The protein is similar with AMYH_YEAST GLUCOAMYLASE S1/S2 PRECURSOR (Acc#P08640). [Mus musculus] Length = 400 Score = 69.9 bits (168), Expect = 7e-12 Identities = 41/79 (51%), Positives = 47/79 (58%) Query: 24 VKGSVTTETVKAPIFFAISAMTGAAPVPVPPPRPHVTKTISAPSKASLSSLSLSLAASSP 83 + G VTT TVKAP AI A TGAAP+PVPPP P V T+ SKA S + S AA P Sbjct: 207 LNGRVTTATVKAPCSLAIRATTGAAPLPVPPPMPAVITTMFGTSKAEAMSSADSSAAFVP 266 Query: 84 IFGSFPAPRPLVNSLPMRI 102 G AP+P VN P+ I Sbjct: 267 RSGFEGAPKPPVNFGPISI 285 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.131 0.369 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35041193 Number of Sequences: 2977 Number of extensions: 1385582 Number of successful extensions: 12150 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 12147 Number of HSP's gapped (non-prelim): 2 length of query: 103 length of database: 189,106,746 effective HSP length: 56 effective length of query: 47 effective length of database: 155,591,474 effective search space: 7312799278 effective search space used: 7312799278 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 159 (66.3 bits)