BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0013 15941 16267 109 !not a gene! (109 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D72686 hypothetical protein APE0908 - Aeropyrum pernix (str... 116 1e-25 >pir||D72686 hypothetical protein APE0908 - Aeropyrum pernix (strain K1) >gi|5104577|dbj|BAA79892.1| (AP000060) 159aa long hypothetical protein [Aeropyrum pernix] Length = 159 Score = 116 bits (287), Expect = 1e-25 Identities = 64/105 (60%), Positives = 74/105 (69%) Query: 2 MTMLGWMFWSSNSSAFLRSSPAMTTAVVVPSPASLSWVLATSTIILAAGCWMSISSRIVA 61 M M+G F S + SAF +PA TT +VVPSP S SW LATST LAAGC +SIS IVA Sbjct: 55 MIMVGCRFSSRSFSAFSSRAPARTTTLVVPSPTSASWALATSTSSLAAGCCISISFTIVA 114 Query: 62 PSFVITMSPRLSTSILSIPFGPRVVLTVSAIILAARMFILWASLP 106 PS V MSP+ STSILS P GPR++L++SA LAA M L ASLP Sbjct: 115 PSLVTVMSPKASTSILSRPLGPRLLLSISASTLAASMLALRASLP 159 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.326 0.130 0.403 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35492722 Number of Sequences: 2977 Number of extensions: 1110759 Number of successful extensions: 4578 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4577 Number of HSP's gapped (non-prelim): 1 length of query: 109 length of database: 189,106,746 effective HSP length: 51 effective length of query: 58 effective length of database: 158,583,909 effective search space: 9197866722 effective search space used: 9197866722 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.8 bits) S2: 159 (66.3 bits)