BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0022 30882 31304 141 !not a gene! (141 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C71221 hypothetical protein PH0030 - Pyrococcus horikoshii ... 90 9e-18 >pir||C71221 hypothetical protein PH0030 - Pyrococcus horikoshii >gi|3256415|dbj|BAA29098.1| (AP000001) 112aa long hypothetical protein [Pyrococcus horikoshii] Length = 112 Score = 90.5 bits (221), Expect = 9e-18 Identities = 46/99 (46%), Positives = 63/99 (63%) Query: 1 MLVLWILRELLVKFIPEFLELLRIRDFRLLPRLNYHRFKILAPHDSPETTSSTSPLRVID 60 MLVL I + LV+FIPE +LLRI + R LN + K+L PH+ + TSST L ++D Sbjct: 1 MLVLRIRGKPLVEFIPEGFKLLRISNLRFFSWLNNYGLKLLTPHNRSKATSSTGSLGIVD 60 Query: 61 YVSYLHQPFTSWAYGGYASIWILPPELFGHFIIPLSPEV 99 Y+SY ++P + YGGY IL P+ FI+PLSPE+ Sbjct: 61 YISYPYEPLSGRTYGGYTCFRILLPQFPSCFIVPLSPEL 99 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.327 0.146 0.489 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64645826 Number of Sequences: 2977 Number of extensions: 2889683 Number of successful extensions: 10632 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 10631 Number of HSP's gapped (non-prelim): 1 length of query: 141 length of database: 189,106,746 effective HSP length: 44 effective length of query: 97 effective length of database: 162,773,318 effective search space: 15789011846 effective search space used: 15789011846 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.7 bits) S2: 161 (67.1 bits)