BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0032 56930 57319 130 !not a gene! (130 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D71224 hypothetical protein PH0055 - Pyrococcus horikoshii ... 220 7e-57 >pir||D71224 hypothetical protein PH0055 - Pyrococcus horikoshii >gi|3256440|dbj|BAA29123.1| (AP000001) 103aa long hypothetical protein [Pyrococcus horikoshii] Length = 103 Score = 220 bits (554), Expect = 7e-57 Identities = 100/103 (97%), Positives = 100/103 (97%) Query: 1 MGTLHRLLSPGPTSSPHPRERAPWPLPLLPSGPCGVWGLKGVSTALQPCLPHRAPRGTRT 60 MGTLHRLLSPGPTSSPHPRERAPWPLPLLPSGPCGVWG KGVSTALQPCLPHRAPRGTRT Sbjct: 1 MGTLHRLLSPGPTSSPHPRERAPWPLPLLPSGPCGVWGPKGVSTALQPCLPHRAPRGTRT 60 Query: 61 HRSALASGGGFGNRPSGFGPGISAVSGYRGRRTPRPSPPPINY 103 HRSALAS GGFGNRPSGFGPGISAVSGYRGRRTPRPSPPPI Y Sbjct: 61 HRSALASRGGFGNRPSGFGPGISAVSGYRGRRTPRPSPPPIMY 103 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.140 0.466 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62807992 Number of Sequences: 2977 Number of extensions: 3166390 Number of successful extensions: 14137 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 14136 Number of HSP's gapped (non-prelim): 1 length of query: 130 length of database: 189,106,746 effective HSP length: 45 effective length of query: 85 effective length of database: 162,174,831 effective search space: 13784860635 effective search space used: 13784860635 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 161 (67.1 bits)