BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0052 (PAB0052) DE:Hypothetical protein (147 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A75196 hypothetical protein PAB0052 - Pyrococcus abyssi (st... 278 2e-74 pir||D71228 hypothetical protein PH0086 - Pyrococcus horikoshii ... 175 3e-43 >pir||A75196 hypothetical protein PAB0052 - Pyrococcus abyssi (strain Orsay) >gi|5457525|emb|CAB49016.1| (AJ248283) hypothetical protein [Pyrococcus abyssi] Length = 147 Score = 278 bits (703), Expect = 2e-74 Identities = 147/147 (100%), Positives = 147/147 (100%) Query: 1 MSSLRSLAMPFLSNSISGATTLTSFIVAYFKAEFILSTNSLVLSGKVSPSSLLKPTIMSP 60 MSSLRSLAMPFLSNSISGATTLTSFIVAYFKAEFILSTNSLVLSGKVSPSSLLKPTIMSP Sbjct: 1 MSSLRSLAMPFLSNSISGATTLTSFIVAYFKAEFILSTNSLVLSGKVSPSSLLKPTIMSP 60 Query: 61 PPRASKREAATPISTKFLAGIQTLLAVSLAFSKSSSSLAVTSGTLPSTNLLPAIFENSCR 120 PPRASKREAATPISTKFLAGIQTLLAVSLAFSKSSSSLAVTSGTLPSTNLLPAIFENSCR Sbjct: 61 PPRASKREAATPISTKFLAGIQTLLAVSLAFSKSSSSLAVTSGTLPSTNLLPAIFENSCR 120 Query: 121 KSIFTIFKGTFNSLEKNSATLFVTLSS 147 KSIFTIFKGTFNSLEKNSATLFVTLSS Sbjct: 121 KSIFTIFKGTFNSLEKNSATLFVTLSS 147 >pir||D71228 hypothetical protein PH0086 - Pyrococcus horikoshii >gi|3256472|dbj|BAA29155.1| (AP000001) 135aa long hypothetical protein [Pyrococcus horikoshii] Length = 135 Score = 175 bits (438), Expect = 3e-43 Identities = 96/130 (73%), Positives = 102/130 (77%) Query: 18 GATTLTSFIVAYFKAEFILSTNSLVLSGKVSPSSLLKPTIMSPPPRASKREAATPISTKF 77 GATTLT FIVAY KA LSTNS VLSGKVSPSSLLKPTI+SPPPRAS+REAA I TKF Sbjct: 3 GATTLTLFIVAYSKALLTLSTNSFVLSGKVSPSSLLKPTIISPPPRASRREAAILIKTKF 62 Query: 78 LAGIQTLLAVSLAFSKSSSSLAVTSGTLPSTNLLPAIFENSCRKSIFTIFKGTFNSLEKN 137 LAG TLLAVSLA S +S+SLA T GT PSTN LP ENS RK IFKG +S EKN Sbjct: 63 LAGTHTLLAVSLALSITSNSLAETLGTFPSTNALPESLENSLRKLTLIIFKGILSSFEKN 122 Query: 138 SATLFVTLSS 147 SATLF+TLSS Sbjct: 123 SATLFITLSS 132 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.315 0.126 0.330 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43672239 Number of Sequences: 2977 Number of extensions: 1441684 Number of successful extensions: 6490 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6488 Number of HSP's gapped (non-prelim): 2 length of query: 147 length of database: 189,106,746 effective HSP length: 64 effective length of query: 83 effective length of database: 150,803,578 effective search space: 12516696974 effective search space used: 12516696974 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 161 (67.1 bits)