BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0080 128515 129042 176 !not a gene! (176 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C71234 hypothetical protein PH0133 - Pyrococcus horikoshii ... 208 2e-53 >pir||C71234 hypothetical protein PH0133 - Pyrococcus horikoshii >gi|3256519|dbj|BAA29202.1| (AP000001) 139aa long hypothetical protein [Pyrococcus horikoshii] Length = 139 Score = 208 bits (525), Expect = 2e-53 Identities = 106/137 (77%), Positives = 113/137 (82%) Query: 40 PKNLISPSLRSKTSSATSRTSSISWVTRIIEWLSSLNFLMTLISPLNPLSSNPVFGSSRT 99 PKN SPS +SKT SATS TSS+SWVT IIE S L FLMTLI +PLSS+PVFGSSRT Sbjct: 3 PKNFSSPSFKSKTLSATSSTSSMSWVTNIIELPSLLKFLMTLIRSWSPLSSSPVFGSSRT 62 Query: 100 RYLGFIAKMHAIASLCFSPPLSSRGLLSSNPSRPTSLKAHLTLFSTSSSLNPRFLGPKAT 159 RY GFIAKMHAIASLCFSPPLSS G L SNP PT+ +AHLTLF TSSSL P+F GPKAT Sbjct: 63 RYFGFIAKMHAIASLCFSPPLSSNGFLFSNPLSPTASRAHLTLFLTSSSLRPKFFGPKAT 122 Query: 160 SLNTFSSKNIASGFWNT 176 SL TFSSKNIASGFWNT Sbjct: 123 SLKTFSSKNIASGFWNT 139 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.315 0.125 0.350 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57736130 Number of Sequences: 2977 Number of extensions: 1990289 Number of successful extensions: 6740 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6739 Number of HSP's gapped (non-prelim): 1 length of query: 176 length of database: 189,106,746 effective HSP length: 61 effective length of query: 115 effective length of database: 152,599,039 effective search space: 17548889485 effective search space used: 17548889485 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 162 (67.5 bits)