BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0107 (PAB0107) DE:Hypothetical protein (179 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||E75204 hypothetical protein PAB0107 - Pyrococcus abyssi (st... 359 1e-98 >pir||E75204 hypothetical protein PAB0107 - Pyrococcus abyssi (strain Orsay) >gi|5457593|emb|CAB49084.1| (AJ248283) hypothetical protein [Pyrococcus abyssi] Length = 179 Score = 359 bits (912), Expect = 1e-98 Identities = 179/179 (100%), Positives = 179/179 (100%) Query: 1 MDGYFNKATNIKIERHIWKRDRGDFLSLSSNPEISPLILLVIGSIFPDLDVFTFFSFESL 60 MDGYFNKATNIKIERHIWKRDRGDFLSLSSNPEISPLILLVIGSIFPDLDVFTFFSFESL Sbjct: 1 MDGYFNKATNIKIERHIWKRDRGDFLSLSSNPEISPLILLVIGSIFPDLDVFTFFSFESL 60 Query: 61 ALHGGEDIRKEHRSYLHSLLFLAPLVLVSLAFKSLFMFTIGAASHLFLDFFSGVIPFFYP 120 ALHGGEDIRKEHRSYLHSLLFLAPLVLVSLAFKSLFMFTIGAASHLFLDFFSGVIPFFYP Sbjct: 61 ALHGGEDIRKEHRSYLHSLLFLAPLVLVSLAFKSLFMFTIGAASHLFLDFFSGVIPFFYP 120 Query: 121 LKRKGYGVKIILSIGTGFSIKAKIILRYPDPKIERKIEISKSIYLLLLTLILFLAKCCK 179 LKRKGYGVKIILSIGTGFSIKAKIILRYPDPKIERKIEISKSIYLLLLTLILFLAKCCK Sbjct: 121 LKRKGYGVKIILSIGTGFSIKAKIILRYPDPKIERKIEISKSIYLLLLTLILFLAKCCK 179 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.330 0.148 0.442 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65965943 Number of Sequences: 2977 Number of extensions: 2624076 Number of successful extensions: 7635 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7634 Number of HSP's gapped (non-prelim): 1 length of query: 179 length of database: 189,106,746 effective HSP length: 49 effective length of query: 130 effective length of database: 159,780,883 effective search space: 20771514790 effective search space used: 20771514790 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.8 bits) S2: 162 (67.5 bits)