BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0166 (PAB0166) DE:Hypothetical protein (269 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||H75214 hypothetical protein PAB0166 - Pyrococcus abyssi (st... 541 e-153 >pir||H75214 hypothetical protein PAB0166 - Pyrococcus abyssi (strain Orsay) >gi|5457676|emb|CAB49167.1| (AJ248283) hypothetical protein [Pyrococcus abyssi] Length = 269 Score = 541 bits (1380), Expect = e-153 Identities = 269/269 (100%), Positives = 269/269 (100%) Query: 1 MKRAWSKIAIFLVLIMVIPGVKALNPVEGRVVVIALIQNGSDSYVTAAFLTNSSGGNVVY 60 MKRAWSKIAIFLVLIMVIPGVKALNPVEGRVVVIALIQNGSDSYVTAAFLTNSSGGNVVY Sbjct: 1 MKRAWSKIAIFLVLIMVIPGVKALNPVEGRVVVIALIQNGSDSYVTAAFLTNSSGGNVVY 60 Query: 61 KGLVKLIEIEDLGKNVRIKVQLNLTDAEPYLENLVKMDFLNEKALRRVIFMDFLVDKEDN 120 KGLVKLIEIEDLGKNVRIKVQLNLTDAEPYLENLVKMDFLNEKALRRVIFMDFLVDKEDN Sbjct: 61 KGLVKLIEIEDLGKNVRIKVQLNLTDAEPYLENLVKMDFLNEKALRRVIFMDFLVDKEDN 120 Query: 121 TFNMNGTRVLFPFLLVEENVKPFHIFEPLRKEKLNVVGSDVVDATKFYSPRTFSYTFCSG 180 TFNMNGTRVLFPFLLVEENVKPFHIFEPLRKEKLNVVGSDVVDATKFYSPRTFSYTFCSG Sbjct: 121 TFNMNGTRVLFPFLLVEENVKPFHIFEPLRKEKLNVVGSDVVDATKFYSPRTFSYTFCSG 180 Query: 181 SIGTRNVTCDPSIKLNYADIIAKSNYVIEANLFFPNDPFGIYNGPVLLSFQINSSELNEP 240 SIGTRNVTCDPSIKLNYADIIAKSNYVIEANLFFPNDPFGIYNGPVLLSFQINSSELNEP Sbjct: 181 SIGTRNVTCDPSIKLNYADIIAKSNYVIEANLFFPNDPFGIYNGPVLLSFQINSSELNEP 240 Query: 241 LMENGQNWGPYLVVFLFFLLGIGAFKMKR 269 LMENGQNWGPYLVVFLFFLLGIGAFKMKR Sbjct: 241 LMENGQNWGPYLVVFLFFLLGIGAFKMKR 269 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.323 0.142 0.414 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99180999 Number of Sequences: 2977 Number of extensions: 4161057 Number of successful extensions: 8842 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8841 Number of HSP's gapped (non-prelim): 1 length of query: 269 length of database: 189,106,746 effective HSP length: 53 effective length of query: 216 effective length of database: 157,386,935 effective search space: 33995577960 effective search space used: 33995577960 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.9 bits) S2: 164 (68.3 bits)