BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0185 (PAB0185) DE:Hypothetical protein (115 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||D75218 hypothetical protein PAB0185 - Pyrococcus abyssi (st... 234 3e-61 pir||G72254 hypothetical protein - Thermotoga maritima (strain M... 108 2e-23 >pir||D75218 hypothetical protein PAB0185 - Pyrococcus abyssi (strain Orsay) >gi|5457704|emb|CAB49195.1| (AJ248283) hypothetical protein [Pyrococcus abyssi] Length = 115 Score = 234 bits (590), Expect = 3e-61 Identities = 115/115 (100%), Positives = 115/115 (100%) Query: 1 MKVYRFTCIVCPLSCTIEVEVEGNSVKSVKGYTCPRGKEWAIEEVLHPKRVVMSVVPVEN 60 MKVYRFTCIVCPLSCTIEVEVEGNSVKSVKGYTCPRGKEWAIEEVLHPKRVVMSVVPVEN Sbjct: 1 MKVYRFTCIVCPLSCTIEVEVEGNSVKSVKGYTCPRGKEWAIEEVLHPKRVVMSVVPVEN 60 Query: 61 GKLPTVSVKTEKPIPKEKIPELMKFLSTLKLKAPVRIGDVVAEFEGVKIVATREA 115 GKLPTVSVKTEKPIPKEKIPELMKFLSTLKLKAPVRIGDVVAEFEGVKIVATREA Sbjct: 61 GKLPTVSVKTEKPIPKEKIPELMKFLSTLKLKAPVRIGDVVAEFEGVKIVATREA 115 >pir||G72254 hypothetical protein - Thermotoga maritima (strain MSB8) >gi|4981999|gb|AAD36504.1|AE001795_7 (AE001795) hypothetical protein [Thermotoga maritima] Length = 138 Score = 108 bits (268), Expect = 2e-23 Identities = 55/110 (50%), Positives = 74/110 (67%), Gaps = 4/110 (3%) Query: 8 CIVCPLSCTIEVEV-EGNSVKSVKGYTCPRGKEWAIEEVLHPKRVVMSVVPVENGKLPTV 66 C+ CP+ C I+VE+ E +KS+ G CPRG E+A +E+ PKRVV + + V NG+LP Sbjct: 7 CVQCPIGCKIKVELTEDGHIKSITGNRCPRGVEYAKDEIKDPKRVVPTSIRVLNGELPLA 66 Query: 67 SVKTEKPIPKEKIPELMKFLSTLKLKAPVRIGDVVAE---FEGVKIVATR 113 SVKT+KPIPK IPELMK + +K++APV+ GDVV G +V TR Sbjct: 67 SVKTDKPIPKRFIPELMKIVREIKVEAPVKAGDVVLRDLFGTGANLVVTR 116 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.318 0.136 0.395 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42335220 Number of Sequences: 2977 Number of extensions: 1642881 Number of successful extensions: 4231 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4228 Number of HSP's gapped (non-prelim): 2 length of query: 115 length of database: 189,106,746 effective HSP length: 53 effective length of query: 62 effective length of database: 157,386,935 effective search space: 9757989970 effective search space used: 9757989970 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)