BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0204 (PAB0204) DE:Hypothetical protein (111 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A75143 hypothetical protein PAB0204 - Pyrococcus abyssi (st... 227 3e-59 pir||E71182 hypothetical protein PH1738 - Pyrococcus horikoshii ... 175 1e-43 >pir||A75143 hypothetical protein PAB0204 - Pyrococcus abyssi (strain Orsay) >gi|5457734|emb|CAB49224.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 111 Score = 227 bits (573), Expect = 3e-59 Identities = 111/111 (100%), Positives = 111/111 (100%) Query: 1 MEDEESNSFWMRLFRKKNENGILEQEINEDVYKELKSLLMRAKPEVIGEKIVLHLPQADV 60 MEDEESNSFWMRLFRKKNENGILEQEINEDVYKELKSLLMRAKPEVIGEKIVLHLPQADV Sbjct: 1 MEDEESNSFWMRLFRKKNENGILEQEINEDVYKELKSLLMRAKPEVIGEKIVLHLPQADV 60 Query: 61 ILTPRRLIVKASNREKAEKILRNLHHYSQPPGLWPAYGLTYSIRKEKGRVS 111 ILTPRRLIVKASNREKAEKILRNLHHYSQPPGLWPAYGLTYSIRKEKGRVS Sbjct: 61 ILTPRRLIVKASNREKAEKILRNLHHYSQPPGLWPAYGLTYSIRKEKGRVS 111 >pir||E71182 hypothetical protein PH1738 - Pyrococcus horikoshii >gi|3258169|dbj|BAA30852.1| (AP000007) 111aa long hypothetical protein [Pyrococcus horikoshii] Length = 111 Score = 175 bits (440), Expect = 1e-43 Identities = 76/111 (68%), Positives = 97/111 (86%) Query: 1 MEDEESNSFWMRLFRKKNENGILEQEINEDVYKELKSLLMRAKPEVIGEKIVLHLPQADV 60 MEDE+SNSFW +LFR+KNE +LEQE+ +D Y+ELK LLMRAKPE+ GE I++HLP+AD+ Sbjct: 1 MEDEDSNSFWSKLFRRKNEEEVLEQEVTDDAYEELKRLLMRAKPEIKGENIIVHLPKADI 60 Query: 61 ILTPRRLIVKASNREKAEKILRNLHHYSQPPGLWPAYGLTYSIRKEKGRVS 111 +L PR+L+++A R+ AEK+LRNLH+YSQPPGLWPAYGLTYSIRKE+ R S Sbjct: 61 VLKPRKLVIRAPTRKDAEKVLRNLHYYSQPPGLWPAYGLTYSIRKERERAS 111 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.316 0.135 0.387 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42859105 Number of Sequences: 2977 Number of extensions: 1578600 Number of successful extensions: 6933 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6931 Number of HSP's gapped (non-prelim): 2 length of query: 111 length of database: 189,106,746 effective HSP length: 54 effective length of query: 57 effective length of database: 156,788,448 effective search space: 8936941536 effective search space used: 8936941536 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.6 bits) S2: 159 (66.3 bits)