BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0227 (PAB0227) DE:Hypothetical protein (103 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||C75149 hypothetical protein PAB0227 - Pyrococcus abyssi (st... 199 9e-51 pir||C71189 hypothetical protein PH1787 - Pyrococcus horikoshii ... 131 2e-30 >pir||C75149 hypothetical protein PAB0227 - Pyrococcus abyssi (strain Orsay) >gi|5457784|emb|CAB49274.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 103 Score = 199 bits (500), Expect = 9e-51 Identities = 103/103 (100%), Positives = 103/103 (100%) Query: 1 MLRTATYLLFLNGFLLLAYGKNAPVYLAFSVLSFILAFGVMKEVKFAIKVALVYSGVNFF 60 MLRTATYLLFLNGFLLLAYGKNAPVYLAFSVLSFILAFGVMKEVKFAIKVALVYSGVNFF Sbjct: 1 MLRTATYLLFLNGFLLLAYGKNAPVYLAFSVLSFILAFGVMKEVKFAIKVALVYSGVNFF 60 Query: 61 FALLFLMAGNLSSSIDAAISLLIVHDILGYIQKKYGEEVKLSA 103 FALLFLMAGNLSSSIDAAISLLIVHDILGYIQKKYGEEVKLSA Sbjct: 61 FALLFLMAGNLSSSIDAAISLLIVHDILGYIQKKYGEEVKLSA 103 >pir||C71189 hypothetical protein PH1787 - Pyrococcus horikoshii >gi|3258223|dbj|BAA30906.1| (AP000007) 103aa long hypothetical protein [Pyrococcus horikoshii] Length = 103 Score = 131 bits (327), Expect = 2e-30 Identities = 66/101 (65%), Positives = 81/101 (79%), Gaps = 2/101 (1%) Query: 1 MLRTATYLLFLNGFLLLAYG--KNAPVYLAFSVLSFILAFGVMKEVKFAIKVALVYSGVN 58 MLR ATY L LNG LLLAY ++ VYLAFS+ SF+LA G+ E++ AIK+ LVYSG+ Sbjct: 1 MLRIATYSLLLNGILLLAYYYINSSYVYLAFSIFSFMLALGIKNEIRLAIKITLVYSGIE 60 Query: 59 FFFALLFLMAGNLSSSIDAAISLLIVHDILGYIQKKYGEEV 99 FF ALL LMAGN++SSIDA ISLLI+HDI+GY Q+KYG+EV Sbjct: 61 FFLALLLLMAGNITSSIDAIISLLILHDIIGYAQRKYGKEV 101 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.331 0.145 0.401 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31241216 Number of Sequences: 2977 Number of extensions: 971032 Number of successful extensions: 3350 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3347 Number of HSP's gapped (non-prelim): 2 length of query: 103 length of database: 189,106,746 effective HSP length: 52 effective length of query: 51 effective length of database: 157,985,422 effective search space: 8057256522 effective search space used: 8057256522 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 40 (21.9 bits) S2: 159 (66.3 bits)