BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0229 344762 345154 131 !not a gene! (131 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||F71189 hypothetical protein PH1790 - Pyrococcus horikoshii ... 228 3e-59 >pir||F71189 hypothetical protein PH1790 - Pyrococcus horikoshii >gi|3258226|dbj|BAA30909.1| (AP000007) 133aa long hypothetical protein [Pyrococcus horikoshii] Length = 133 Score = 228 bits (574), Expect = 3e-59 Identities = 116/131 (88%), Positives = 122/131 (92%) Query: 1 MSITSFSSSSGTWNRTINRIASTFGSFMKASRASLYLSASVSPTTSVGFPTTACGGNLSL 60 M ITS SSS+GTW RTI RIASTFGSF+KAS+A+LYLSASVSPTTSVGFPTTACGGNLSL Sbjct: 3 MLITSSSSSNGTWKRTIRRIASTFGSFVKASKANLYLSASVSPTTSVGFPTTACGGNLSL 62 Query: 61 RNFIVSSLSSASLRPNLATASLAITPAPPPSVIIPILSPLGSLHFAKALAKSNMCSKSSA 120 +NFIVSSLSSAS PN ATASLAITPAPPPSVIIPILSPLG+LH AKALAKSNMCSKSSA Sbjct: 63 KNFIVSSLSSASFNPNFATASLAITPAPPPSVIIPILSPLGNLHLAKALAKSNMCSKSSA 122 Query: 121 LIIPVCLNTAS 131 LIIPVCL TAS Sbjct: 123 LIIPVCLKTAS 133 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.315 0.125 0.349 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42634340 Number of Sequences: 2977 Number of extensions: 1481254 Number of successful extensions: 7572 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7571 Number of HSP's gapped (non-prelim): 1 length of query: 131 length of database: 189,106,746 effective HSP length: 60 effective length of query: 71 effective length of database: 153,197,526 effective search space: 10877024346 effective search space used: 10877024346 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.7 bits) S2: 160 (66.7 bits)