BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0232 (PAB0232) DE:Hypothetical protein (144 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G75149 hypothetical protein PAB0232 - Pyrococcus abyssi (st... 293 5e-79 pir||B71190 hypothetical protein PH1794 - Pyrococcus horikoshii ... 251 2e-66 >pir||G75149 hypothetical protein PAB0232 - Pyrococcus abyssi (strain Orsay) >gi|5457788|emb|CAB49278.1| (AJ248284) hypothetical protein [Pyrococcus abyssi] Length = 144 Score = 293 bits (743), Expect = 5e-79 Identities = 144/144 (100%), Positives = 144/144 (100%) Query: 1 MLLTNHAKERIAKRLAKRKKIDRIYSALFSFLKNSIRIEVEGTILFTDGSKTLVATRLNG 60 MLLTNHAKERIAKRLAKRKKIDRIYSALFSFLKNSIRIEVEGTILFTDGSKTLVATRLNG Sbjct: 1 MLLTNHAKERIAKRLAKRKKIDRIYSALFSFLKNSIRIEVEGTILFTDGSKTLVATRLNG 60 Query: 61 EYLDLKDIIGRVKDIEENYECVFWDRRIVKITKPGKFLQDVSPGKYYFYINKEKKTLYIG 120 EYLDLKDIIGRVKDIEENYECVFWDRRIVKITKPGKFLQDVSPGKYYFYINKEKKTLYIG Sbjct: 61 EYLDLKDIIGRVKDIEENYECVFWDRRIVKITKPGKFLQDVSPGKYYFYINKEKKTLYIG 120 Query: 121 TQEPLLALTFRPAKRWERALFYFT 144 TQEPLLALTFRPAKRWERALFYFT Sbjct: 121 TQEPLLALTFRPAKRWERALFYFT 144 >pir||B71190 hypothetical protein PH1794 - Pyrococcus horikoshii >gi|3258230|dbj|BAA30913.1| (AP000007) 158aa long hypothetical protein [Pyrococcus horikoshii] Length = 158 Score = 251 bits (635), Expect = 2e-66 Identities = 120/144 (83%), Positives = 135/144 (93%) Query: 1 MLLTNHAKERIAKRLAKRKKIDRIYSALFSFLKNSIRIEVEGTILFTDGSKTLVATRLNG 60 MLLT HAKERIAKRLAK++KID+IYSALFSFLKNSIRIE+EGTI FTDGSKTLVAT+L+G Sbjct: 15 MLLTKHAKERIAKRLAKKRKIDKIYSALFSFLKNSIRIEIEGTIFFTDGSKTLVATKLDG 74 Query: 61 EYLDLKDIIGRVKDIEENYECVFWDRRIVKITKPGKFLQDVSPGKYYFYINKEKKTLYIG 120 + LDL+DII RV+ IEE+YECVFWD++IVKITKP KFLQ+V PGKYYFYINKEKK LYIG Sbjct: 75 KLLDLEDIIRRVRGIEESYECVFWDKKIVKITKPRKFLQEVPPGKYYFYINKEKKVLYIG 134 Query: 121 TQEPLLALTFRPAKRWERALFYFT 144 + EPLLALTFRPAKRWERALFYF+ Sbjct: 135 SHEPLLALTFRPAKRWERALFYFS 158 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.324 0.142 0.414 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53347932 Number of Sequences: 2977 Number of extensions: 2132655 Number of successful extensions: 4769 Number of sequences better than 1.0e-10: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4767 Number of HSP's gapped (non-prelim): 2 length of query: 144 length of database: 189,106,746 effective HSP length: 51 effective length of query: 93 effective length of database: 158,583,909 effective search space: 14748303537 effective search space used: 14748303537 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (22.0 bits) S2: 161 (67.1 bits)