BLASTP 2.0.10 [Aug-26-1999] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= PAB0236 350952 351335 128 !not a gene! (128 letters) Database: ./suso.pep; /banques/blast2/nr.pep 598,487 sequences; 189,106,746 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||G71190 hypothetical protein PH1799 - Pyrococcus horikoshii ... 165 2e-40 >pir||G71190 hypothetical protein PH1799 - Pyrococcus horikoshii >gi|3258235|dbj|BAA30918.1| (AP000007) 117aa long hypothetical protein [Pyrococcus horikoshii] Length = 117 Score = 165 bits (413), Expect = 2e-40 Identities = 88/116 (75%), Positives = 96/116 (81%) Query: 12 ITVSPSANLIAFSILGSYSMTSMTGVPTESLTFFGFILLSGRNVSLPSLFLLRNSIAFSA 71 +TVSP A L AFSILGSYSMT TG+PT T FILLSGR V+LPSLFL +NSIAFSA Sbjct: 1 MTVSPRAKLTAFSILGSYSMTLTTGIPTSPFTCRAFILLSGRKVNLPSLFLFKNSIAFSA 60 Query: 72 TISFSTTTLSALFPRATSTAIEYISSFTLINSNKVPYIPLIPDLLSSSTALLTLTS 127 TIS STTTLSAL P+ATSTA+EY SS TLINS+KVPY+P IPDLLSSSTALL L S Sbjct: 61 TISSSTTTLSALLPKATSTAMEYFSSLTLINSSKVPYMPGIPDLLSSSTALLLLVS 116 Database: ./suso.pep Posted date: Jul 6, 2001 5:57 PM Number of letters in database: 840,471 Number of sequences in database: 2977 Database: /banques/blast2/nr.pep Posted date: Dec 14, 2000 12:46 PM Number of letters in database: 188,266,275 Number of sequences in database: 595,510 Lambda K H 0.319 0.130 0.344 Gapped Lambda K H 0.270 0.0470 0.230 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37929831 Number of Sequences: 2977 Number of extensions: 1244145 Number of successful extensions: 4763 Number of sequences better than 1.0e-10: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4762 Number of HSP's gapped (non-prelim): 1 length of query: 128 length of database: 189,106,746 effective HSP length: 61 effective length of query: 67 effective length of database: 152,599,039 effective search space: 10224135613 effective search space used: 10224135613 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.8 bits) X3: 64 (24.9 bits) S1: 41 (21.8 bits) S2: 160 (66.7 bits)